KEGG   Listeria monocytogenes L312 (serotype 4b): LMOL312_1763Help
Entry
LMOL312_1763      CDS       T02247                                 

Gene name
gatC
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lmol  Listeria monocytogenes L312 (serotype 4b)
Pathway
lmol00970  Aminoacyl-tRNA biosynthesis
lmol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmol00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMOL312_1763 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmol03029]
    LMOL312_1763 (gatC)
Enzymes [BR:lmol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LMOL312_1763 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LMOL312_1763 (gatC)
Mitochondrial biogenesis [BR:lmol03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LMOL312_1763 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF1152
Motif
Other DBs
NCBI-ProteinID: CBY67841
Position
complement(1812662..1812955)
Genome map
AA seq 97 aa AA seqDB search
MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVS
NVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaatatatcaaaagaaacagtagaaaaagtagcaaatcttgccaaactagaagta
tcagaaacagaagcaacagccttcgctggtcagcttggtaaaattattgagctagtagag
caattaaatacattagatacaacgaatgtagaacctaccagccatgcaatcgacgtatca
aacgtattacgtgaagatgtggcaacaaaagggttggatcgcaaagaagtactaaaaaat
gcgcctgatgaacaagatggcatgttcaaagtaccgacaattatggaacaataa

DBGET integrated database retrieval system