KEGG   Listeria monocytogenes Lm60: IJ09_02935Help
Entry
IJ09_02935        CDS       T03479                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmom  Listeria monocytogenes Lm60
Pathway
lmom00071  Fatty acid degradation
lmom00072  Synthesis and degradation of ketone bodies
lmom00280  Valine, leucine and isoleucine degradation
lmom00310  Lysine degradation
lmom00362  Benzoate degradation
lmom00380  Tryptophan metabolism
lmom00620  Pyruvate metabolism
lmom00630  Glyoxylate and dicarboxylate metabolism
lmom00640  Propanoate metabolism
lmom00650  Butanoate metabolism
lmom00900  Terpenoid backbone biosynthesis
lmom01100  Metabolic pathways
lmom01110  Biosynthesis of secondary metabolites
lmom01120  Microbial metabolism in diverse environments
lmom01130  Biosynthesis of antibiotics
lmom01200  Carbon metabolism
lmom01212  Fatty acid metabolism
lmom02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmom00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IJ09_02935
   00630 Glyoxylate and dicarboxylate metabolism
    IJ09_02935
   00640 Propanoate metabolism
    IJ09_02935
   00650 Butanoate metabolism
    IJ09_02935
  Lipid metabolism
   00071 Fatty acid degradation
    IJ09_02935
   00072 Synthesis and degradation of ketone bodies
    IJ09_02935
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IJ09_02935
   00310 Lysine degradation
    IJ09_02935
   00380 Tryptophan metabolism
    IJ09_02935
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IJ09_02935
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IJ09_02935
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IJ09_02935
Enzymes [BR:lmom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IJ09_02935
Exosome [BR:lmom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IJ09_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIL66751
Position
592510..593679
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPKRVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASTQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVNPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccaaaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtacacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
aatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system