KEGG   Listeria monocytogenes Lm60 (serotype 1/2a): IJ09_13665Help
Entry
IJ09_13665        CDS       T03479                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    IJ09_13665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIL68782
UniProt: A0A1D2J0L2
Position
complement(2652481..2653479)
Genome map
AA seq 332 aa AA seqDB search
MEGMFLITLVIVLAALAFDLINGFHDTANAIATSVSTKALKPRHAIILAAVMNFVGAISF
TGVAKTITKDIVNPFDLDHGELVILAALLSAIAWNLITWYFGIPSSSSHALIGSIAGAAI
ASAGFAAIEYSGFTKIIIGLLVSPVLAFVVGYTIYSLFKVFLKNLNLATTNRRFRMIQVG
TAALQSYTHGTNDAQKSMGIITMALIASGFQTTDDVQLWVQVSCAIAMAIGTSIGGWKII
KTVGGKIMKIKPVNGVAADLSSVIIIFGATFIHLPVSTTHVISSSILGVGTAHRVKGVKW
DTAQRMIITWVITLPISATIAALIFYVLRFIL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatgtttctcatcaccctcgtcatcgtacttgccgcgctagcatttgaccta
atcaacgggtttcatgatacagctaacgcaattgcgactagtgtctctacaaaagcctta
aaaccacgacatgcgattatcctcgctgccgtaatgaactttgtgggtgctatatcattc
acaggggttgctaaaacaattacaaaagacattgttaacccatttgacttagatcacggg
gaacttgttattttagcagcattactttcagctattgcttggaatttaatcacttggtat
ttcggaattcctagtagttcctctcatgccttgattggttccatcgccggtgcagcaatt
gcatcagctggatttgcagcaattgaatacagcggatttactaaaatcatcattggttta
ttagtatcccctgtacttgctttcgtagtcggttacacgatatattcactcttcaaggtt
ttcttgaagaacttaaacttagccacgaccaatcggcgcttccggatgattcaagtcgga
actgccgcgctacaatcttacacacacggaaccaatgatgcccaaaaatcaatggggatt
atcacaatggcattaattgctagtggtttccaaacaacggatgatgtgcaattatgggtt
caagtatcctgtgcgattgctatggcgattggtacgagtattggtggttggaaaatcatc
aaaactgtcggtggtaaaatcatgaaaatcaaaccagttaatggtgtagcagctgattta
agttccgttatcattatttttggtgccactttcattcatttaccagttagtacaacacac
gtaatcagctcttctatcctaggtgttggaacagctcaccgtgttaaaggtgtcaaatgg
gatactgctcagcgcatgattattacatgggttatcacacttcctatttccgcaacgatt
gcagcacttatcttctatgtgctaagattcattctttaa

DBGET integrated database retrieval system