KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_0853Help
Entry
LMOSLCC2376_0853  CDS       T02222                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00860  Porphyrin and chlorophyll metabolism
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC2376_0853 (hemG)
Enzymes [BR:lmon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMOSLCC2376_0853 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     LMOSLCC2376_0853 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_3 Thi4 Pyr_redox_2 HI0933_like FAD_binding_2 Pyr_redox Trp_halogenase GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CBY62885
Position
891024..892403
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVNDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATNITKKNSSYEISFADGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLTDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNVK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAINELAEYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacttgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggtcaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggcgtaggcttagtgaatgatttaggactcgaagataaactgatt
gcgaatgcgaccggaagatcctatatttatcatcaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagacaaagaagcgctgctagcaagcacgctcgtatcg
gaaattggcaaagcacgagcacttcaagaaccaacaatggaacggaataatcaagaacaa
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgctggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacggttaaaaaatacggaaatttgatggatggtttgaaa
gaaagtagcatgcaaacgacaggtacaaaagcaactattggtgcttttcgaacattagaa
ggcgggctagacgctttaccaaaagccattgcggccgcacttccaaaagaaaacttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatctcgtttgca
gatggcgataaaatggaagcagatggcgtcattattgctgccacacatgatgcgttaatt
catttgttagctgaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagacgggacgggctac
ttagttgccagaaccgcgccgtataaaaccaccgcctgtacttgggtgcagaaaaaatgg
ccgcatatggtgccaaagaataaaatgttactacgaggttttgtcggaaaagcaggggaa
acttggttagagcaagcaagcgatgaagcaatcgtctctgctgttttgacagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgccacaatacttagtcaatcaccaagaccggctaaaacaattgaaaaagaacgtcaag
gcagattacccaggtgtctattttgcaggaatgagttacgaaggtgtgggtattcctgat
tgcatcgctggggcacaaacagccattaatgaattagcagaatacttggaagaggtgtaa

DBGET integrated database retrieval system