KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1370Help
Entry
LMOSLCC2376_1370  CDS       T02222                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmon  Listeria monocytogenes SLCC2376 (serotype 4c)
Pathway
lmon00071  Fatty acid degradation
lmon00072  Synthesis and degradation of ketone bodies
lmon00280  Valine, leucine and isoleucine degradation
lmon00310  Lysine degradation
lmon00362  Benzoate degradation
lmon00380  Tryptophan metabolism
lmon00620  Pyruvate metabolism
lmon00630  Glyoxylate and dicarboxylate metabolism
lmon00640  Propanoate metabolism
lmon00650  Butanoate metabolism
lmon00900  Terpenoid backbone biosynthesis
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01120  Microbial metabolism in diverse environments
lmon01130  Biosynthesis of antibiotics
lmon01200  Carbon metabolism
lmon01212  Fatty acid metabolism
lmon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2376_1370
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC2376_1370
   00640 Propanoate metabolism
    LMOSLCC2376_1370
   00650 Butanoate metabolism
    LMOSLCC2376_1370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC2376_1370
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC2376_1370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC2376_1370
   00310 Lysine degradation
    LMOSLCC2376_1370
   00380 Tryptophan metabolism
    LMOSLCC2376_1370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2376_1370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC2376_1370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC2376_1370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmon04147]
    LMOSLCC2376_1370
Enzymes [BR:lmon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC2376_1370
Exosome [BR:lmon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2376_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY63402
Position
complement(1392604..1393773)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVELGATALKGVLERANIAPDRVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKSIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKNLRNSMLIDGLTDVYGDYHMGITAENVAEKFSVTREEQDKFAH
NSQMKAASAQEKNLFEEEIIPVKLADGSFFEADETIRANSTLEKLATLKSVFKEDGTVTA
GNASGINDGASALILMSKEKAIAENIPYIATIKVTSEVGVDPAYMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEDKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHLGVASLCIGGGIGIAIIVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaattcggtggcagt
ttgaaagacatcagtgcagtagaacttggcgctaccgctctaaaaggcgtattagaaaga
gccaacattgctccagaccgcgtagatcaagttatttttggtaacgttttgcaagccggt
cttggtcaaaacgtagctagacaagtcgctattaaagcaggaattccttataaagtacca
ggagtcacaatcaatgaagtttgtggatctggtttaaaatcgattatgcttggaagacaa
gcaatccaattaggcgaggccgacattgtagcagtgggagggaccgaaaacatgtctcaa
gcaccactattacttaatccggaactagccggcgaagaaattgatcccaaaaacttaaga
aatagcatgttaattgatggtttaacggatgtgtacggcgattatcacatgggaattaca
gccgaaaatgtagcagaaaaattctctgtaacccgagaagagcaagataaatttgcacat
aactcccaaatgaaagcagcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
ccagtgaaacttgcagatggttcgtttttcgaagccgatgaaacgattcgtgcgaattcc
actttagaaaaactagctacattgaaaagcgtatttaaagaagatggtacagtcacagct
ggtaatgcttccgggatcaatgacggagcttctgcgcttattttaatgtcgaaggaaaag
gccattgccgaaaatattccttatatcgcgacaatcaaagtaacttcagaagttggtgtt
gatccagcatatatgggttacgcgccttactatgcagtaaatgaagcattaactaaaggg
ggatattctatcgatgacattgatctatttcatttaaatgaagcttttgcgtcacagtcg
gttgccgtagctcgtgatttgaaaattccagaagataaactgaatatttacggcggagca
attgcgttaggtcatccaatcggagcatccggagcacgcattattgcctccttattaaat
gagttaaaacacgaaaataaacatcttggcgtggcttccttatgtatcggcggcggtatt
ggaattgcaattattgtcgaaagagcttga

DBGET integrated database retrieval system