KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_2349Help
Entry
LMOSLCC2376_2349  CDS       T02222                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00010  Glycolysis / Gluconeogenesis
lmon00051  Fructose and mannose metabolism
lmon00562  Inositol phosphate metabolism
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01120  Microbial metabolism in diverse environments
lmon01130  Biosynthesis of antibiotics
lmon01200  Carbon metabolism
lmon01230  Biosynthesis of amino acids
Module
lmon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmon_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2376_2349 (tpi)
   00051 Fructose and mannose metabolism
    LMOSLCC2376_2349 (tpi)
   00562 Inositol phosphate metabolism
    LMOSLCC2376_2349 (tpi)
Enzymes [BR:lmon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2376_2349 (tpi)
Exosome [BR:lmon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2376_2349 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2376_2349 (tpi)
  Exosomal proteins of melanoma cells
   LMOSLCC2376_2349 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY64381
Position
complement(2424084..2424839)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaataaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgc
gtagctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tatttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacatggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system