KEGG   Listeria monocytogenes SLCC2376 (serotype 4c): LMOSLCC2376_2363Help
Entry
LMOSLCC2376_2363  CDS       T02222                                 

Definition
(GenBank) NADH:flavin oxidoreductase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
lmon  Listeria monocytogenes SLCC2376 (serotype 4c)
Brite
KEGG Orthology (KO) [BR:lmon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMOSLCC2376_2363
Enzymes [BR:lmon01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     LMOSLCC2376_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus
Motif
Other DBs
NCBI-ProteinID: CBY64395
Position
complement(2440871..2441887)
Genome map
AA seq 338 aa AA seqDB search
MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILEAT
AVQEVGRISEFDLGLWNDEQVPALKRLVDGLHYHGAKAGIQLAHAGRKAVLPGEIVAPSA
IAFDEKSDKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNR
REDNYGGPAGNRYKILSDIIKAVKEVWDGPIIVRVSATDYAHGGLQLEDHIPFAKWMKAD
GVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEILCNERA
DLIIVGRELLRNPYFAKDAAKQLGETIEGPKQYSRAWK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattattttcagaatataaattaaaagatgtaacgctaaaaaacagaattgtt
atgtcaccaatgtgtatgtattcagtagaaaataaagacgggatcgcaacagactttcat
tttgcacactatgtctcgagagctgcaggtggtacagggcttgtcattttagaagctacg
gctgttcaagaagtaggccgtatttctgaatttgatttaggattatggaatgacgagcaa
gttccagctttaaaacgtctagtagatggacttcattaccacggagcaaaagcaggaatt
caattagcgcacgctggaagaaaagctgttttacctggtgaaatagtggctccttctgct
attgcttttgatgaaaaatcggataaaccagtagagcttacgaaagaagcgattaaagag
gttgtggctgatttcaaacgcgccgcttatcgtgcaaaagaagctggatttgatgtgatt
gagattcacgctgctcatggttatttaattcaccaattcttatcaccaattacgaatcgt
cgcgaagataattacggtggacctgctggcaatcgatataaaattttaagtgatattatt
aaagcggtgaaggaagtatgggacggcccgattatcgttcgagtttccgctactgactat
gcccatggcggtttgcaactagaagatcatattccttttgcaaaatggatgaaagcagat
ggcgtggaactaattgatgtgagtacaggtggtttagttaatgtggctccaccagttttc
ccaggttatcaagtgccattcgcggatgaaattcgtcgcggggcgggtattgcgaccgga
gcgcttgggcttattacacgaggcgaacaagcggaagaaattttgtgcaatgaacgagcg
gatttaattattgtaggtcgtgaattattacgaaatccttattttgctaaagatgcagcc
aaacaattaggcgaaacaattgaaggaccaaaacaatattcacgcgcgtggaaataa

DBGET integrated database retrieval system