KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_2615Help
Entry
LMOSLCC2376_2615  CDS       T02222                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00010  Glycolysis / Gluconeogenesis
lmon00620  Pyruvate metabolism
lmon00640  Propanoate metabolism
lmon00680  Methane metabolism
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01120  Microbial metabolism in diverse environments
lmon01130  Biosynthesis of antibiotics
lmon01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2376_2615 (acsA)
   00620 Pyruvate metabolism
    LMOSLCC2376_2615 (acsA)
   00640 Propanoate metabolism
    LMOSLCC2376_2615 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2376_2615 (acsA)
Enzymes [BR:lmon01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOSLCC2376_2615 (acsA)
Lipid biosynthesis proteins [BR:lmon01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOSLCC2376_2615 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY64647
Position
2690463..2692040
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHYANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaacaaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacttacgcaatt
tacatgggcttatggaaagctggtgccataatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccattacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaatcattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgatcattggctcgatattcacgaagacgatatcgtttgggccacagctggccct
ggttggcaaaaatgggtttggtctcctttcctttctgttctcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggcaaaggttaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagttattcaagttttccaagataattttgatattaaagttcgcgacggctacggccaa
acggaaagcacgctgttgattggaacacttgttgatacgccgattcgccctggttcaatg
ggcaaacccattatgcctgaatacatggcgattattgatgctgacggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagaatac
tataaagaaccagaacgtttgcaaaaagcgattcgtggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
atcagctctggctacacgattggaccgttcgaagtagaggacgcgctcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagtcctgatgaaatccgcggtacggtcgtaaaa
gcattcatcgtcttaaaagatggttacgagggcacggaagatcttgtgcatgagttacaa
acatttactaaagaacaaaccgctccgtataaatacccgcgccggattgagtttgttgag
gcgttaccgaaaactgattctggtaaaattcgccgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system