KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_0292Help
Entry
LMOSLCC2378_0292  CDS       T02240                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo00010  Glycolysis / Gluconeogenesis
lmoo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2378_0292
   00500 Starch and sucrose metabolism
    LMOSLCC2378_0292
Enzymes [BR:lmoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC2378_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CBY72059
Position
complement(310891..312327)
Genome map
AA seq 478 aa AA seqDB search
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDH
YHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFYDNLIDELLKYDIEPLV
TLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYG
QALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNV
QAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLSSAKPDFMGVNY
YQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGL
QIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcaaaaacgttcaccattcccgaaagatttcttatggggttctgcatcggca
gcttatcaaatcgaaggcgcatgggacgcagacggcaaaggtaaatcagtttgggacgaa
tatgtccgcattcctggaactactttcaaaggtacaaatggcgatgtagctgtcgaccat
tatcaccgttataaagaagacgtaaaactaatggcagacgctggcctaaaagcttaccgt
ttctctatcgcttggactcgtatttttccaaatggtaaaggcgaagtgaatgaagctgga
ttgaaattttatgataacttgattgatgagttgcttaaatatgacattgaaccgcttgta
acgctttatcactgggatatcccacaagcattatttgatgaatacggtggctgggaatct
cgccaagttattgaagatttcacaaattattccacaacgctattcaaacgttacggcgac
cgcgtgaaatattgggtttccttgaatgagcaaaatatctttgttggtatgggttatggt
caagcgcttcacccgccaaaagttagcgatccaaaaagaatgtacgcagtaaaccacatt
gcgaacttagctaatgcgagtgttatcaaagctttccacgaaatcgttcctgatggaaaa
attggaccaagttttgcttacacaccacattatccaatcgacacagatcctaaaaacgtt
caagctgccgacgatgcagaagaattaaacagttatttctggatggatatgtatgctttt
gggcgctatccgaaagcggtttggaaatatttagaagaaaacgatattgcgccagttatt
gaagacggcgatatggaacttctttcttctgcaaaaccagatttcatgggcgtaaactat
taccaatccgcaactgttgcttacaacccgcttgatggcgttggtcaaaacaacgaaatg
aacttcactggtaaaaaaggtagcacgaaagaaactggtgtccctggcgtttacaaaaaa
gtcgttaatccttttgtgaaaacaacgaactgggactggacaatcgatccaaaaggctta
caaattgcgcttcgtcgtattaacagccgctatgctttaccaattttaattacagaaaac
ggtttaggtgaatttgataaattagtggacggagaagtaaacgatgactaccgtattgac
tatctaagcgcgcacgcaactgctattcgcgatgcaatcagtgatggtgttgatatgtta
ggctattgtacttggagcttcacagaccttctaagctggttaaacggctatcaaaaacgt
tacggttttgtttatgttgaccgcgatgtggaagatgatgcgccaatgacacgtattccg
aagaaaagttattattggtataaacaagtgattgaaactaatggagcagatttataa

DBGET integrated database retrieval system