KEGG   Listeria monocytogenes SLCC2378 (serotype 4e): LMOSLCC2378_0991Help
Entry
LMOSLCC2378_0991  CDS       T02240                                 

Gene name
dltA
Definition
(GenBank) D-alanine-activating enzyme/D-alanine-D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lmoo  Listeria monocytogenes SLCC2378 (serotype 4e)
Pathway
lmoo00473  D-Alanine metabolism
lmoo01100  Metabolic pathways
lmoo01503  Cationic antimicrobial peptide (CAMP) resistance
lmoo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMOSLCC2378_0991 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC2378_0991 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LMOSLCC2378_0991 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lmoo01504]
    LMOSLCC2378_0991 (dltA)
Enzymes [BR:lmoo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LMOSLCC2378_0991 (dltA)
Antimicrobial resistance genes [BR:lmoo01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LMOSLCC2378_0991 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY72758
Position
complement(1006198..1007730)
Genome map
AA seq 510 aa AA seqDB search
MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKNLNTDKEKPIIVY
GHMSPLMLVAFLGSIKSGRAYVPVDVSMPVERIEQIKKAADPSLFICTEELPSNLTITGC
PVLTQDQLMDALEKHFGEVPDKEACVKNDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNW
ILQDFSLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITANMKDLYREIPAQN
LDVWVSTPSFADLCLLDDNFNQENNPGLIRFLFCGEVLAKKTASELLNRFPDAVIYNTYG
PTEATVAVTQVKVTREVIDAYPSLPLGVIKPDMRLHIVDQETGEVLPEGEKGEIVLIGAS
VSKGYLNEPEKTDQVFFDYKGYQAYRTGDSGIIKDGYLFFQGRLDFQIKLHGYRIELEDI
ENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPTNHDFEKEYQLSAAIKNELKEFMPAYM
IPRKWIYKTEFPLTMNGKIDRKALNSEVNK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgagtatcatagaaagaattgatgcatgggcagagaagacaccggatttccct
tgctatgaatatgctggaacacgtctttcctataaagaactaaaacgacaatctgatgca
ttcggctcttttctactaaaaaacctaaatactgacaaagaaaaacctattatcgtttac
ggacatatgtctcccctaatgctagttgcatttttaggctctatcaaatcaggtcgagct
tatgtaccagtagatgtttctatgccagttgaacgtatagaacaaattaaaaaagcagct
gatccttctttgtttatttgtacagaagagctacctagtaaccttactattactggttgt
ccggtactaacacaagatcagctaatggacgccttagagaaacatttcggagaagttcca
gataaagaagcatgtgtaaaaaatgatgataactactatattatttacacatccggaagt
acaggaaatcctaaaggggttcaaatcagtcaaaacaatctagtaagttttagtaactgg
atattacaagacttttctttaagccaaggattgcgtttcttaaaccaagcacccttttcc
ttcgatctatccgttatggatttatatccaagtttactatcgggtggaacgcttgtacct
cttgataaaacaattactgcgaatatgaaagatttatatcgtgaaatacctgctcaaaac
ttggatgtatgggtttctactccttcttttgctgatttgtgcttactagacgataacttt
aaccaagaaaataaccctggcttaattcgtttcttattctgtggtgaagtacttgccaag
aaaacagcaagcgaattgctgaaccgtttcccagatgcagttatttacaacacatacgga
cctacagaagcaaccgtggctgtcactcaagtaaaagtaactcgagaggttatcgatgct
tatccaagcttaccacttggcgttattaaaccagatatgcgtttacacatcgttgaccaa
gaaactggtgaggttcttccagaaggcgaaaaaggagaaattgtcctgattggtgctagc
gtttctaaaggttacttaaatgaacctgaaaaaacagaccaagtattcttcgactataaa
ggttatcaagcttatcgcacaggagactctggcattatcaaagacggttatctgttcttc
caaggacgtcttgacttccaaattaaactgcatggttatcgcatcgaattagaagatatc
gaaaacaacctaaaaaaagtaagttacattcaaaactgcgctattattcctaaaatgaaa
gatgaaaaggtagatatgttggtcgcacaggtcatccctactaaccatgatttcgaaaaa
gaataccagctaagtgcagcaataaaaaatgaactgaaagaatttatgccagcatacatg
atcccaagaaaatggatttacaaaacggaattcccgttaactatgaatggcaaaatcgat
cgcaaggcgcttaatagcgaggttaacaagtga

DBGET integrated database retrieval system