KEGG   Listeria monocytogenes SLCC2378 (serotype 4e): LMOSLCC2378_1430Help
Entry
LMOSLCC2378_1430  CDS       T02240                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoo  Listeria monocytogenes SLCC2378 (serotype 4e)
Pathway
lmoo00071  Fatty acid degradation
lmoo00072  Synthesis and degradation of ketone bodies
lmoo00280  Valine, leucine and isoleucine degradation
lmoo00310  Lysine degradation
lmoo00362  Benzoate degradation
lmoo00380  Tryptophan metabolism
lmoo00620  Pyruvate metabolism
lmoo00630  Glyoxylate and dicarboxylate metabolism
lmoo00640  Propanoate metabolism
lmoo00650  Butanoate metabolism
lmoo00900  Terpenoid backbone biosynthesis
lmoo01100  Metabolic pathways
lmoo01110  Biosynthesis of secondary metabolites
lmoo01120  Microbial metabolism in diverse environments
lmoo01130  Biosynthesis of antibiotics
lmoo01200  Carbon metabolism
lmoo01212  Fatty acid metabolism
lmoo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2378_1430
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC2378_1430
   00640 Propanoate metabolism
    LMOSLCC2378_1430
   00650 Butanoate metabolism
    LMOSLCC2378_1430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC2378_1430
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC2378_1430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC2378_1430
   00310 Lysine degradation
    LMOSLCC2378_1430
   00380 Tryptophan metabolism
    LMOSLCC2378_1430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2378_1430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC2378_1430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC2378_1430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoo04147]
    LMOSLCC2378_1430
Enzymes [BR:lmoo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC2378_1430
Exosome [BR:lmoo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2378_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY73197
Position
complement(1424579..1425748)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system