KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1861Help
Entry
LMOSLCC2378_1861  CDS       T02240                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo00240  Pyrimidine metabolism
lmoo00250  Alanine, aspartate and glutamate metabolism
lmoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMOSLCC2378_1861 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2378_1861 (pyrB)
Enzymes [BR:lmoo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LMOSLCC2378_1861 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CBY73628
Position
complement(1895573..1896484)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYAGLEKLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESYLAYGTYLSVDEIVEKVDVLMLLRVQHERHSGTDEFTKESYHEKFGLTENRAK
QLKEDAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcagagaaaaag
ttaggtgtggaggttgtttcttttgatgcagcgagctctagcatgacaaaaggagaaacg
ctctacgatacactgctcacaatgcaagccgtcggggtcaatgtcgcagtgattagacac
tcagaagaaaattactatgcgggactcgaaaaattagacattgctattgtgaacggcggt
gatggatgcggtgaacatccgagtcaatcactacttgacttatttacaataaaagaacaa
tttggtacttttcagggtttgaaagtagcgattgctggtgatattcgtcacagtcgagtt
gccaattccaatatgaaagtgttaaaaagacttggtgcggaactgtttttctccggaccg
agagaatggttcgacgaaagttacttagcatatggcacttacttatcggttgatgaaatt
gtggaaaaagtggatgtgttgatgcttttgcgtgtacaacatgagcgccatagtggaaca
gatgagtttacgaaagaaagctaccacgaaaaatttggattgacggaaaatcgggcaaag
cagttaaaagaagatgcaatcattatgcacccaagccctgtgaaccgagatgtggaaatt
gctgatagtttagtagaaagcgaaaaatcacgcattgttacgcaaatgacgaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system