KEGG   Listeria monocytogenes 6179 (serotype 1/2a): LM6179_2158Help
Entry
LM6179_2158       CDS       T03159                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoq  Listeria monocytogenes 6179 (serotype 1/2a)
Pathway
lmoq00071  Fatty acid degradation
lmoq00072  Synthesis and degradation of ketone bodies
lmoq00280  Valine, leucine and isoleucine degradation
lmoq00310  Lysine degradation
lmoq00362  Benzoate degradation
lmoq00380  Tryptophan metabolism
lmoq00620  Pyruvate metabolism
lmoq00630  Glyoxylate and dicarboxylate metabolism
lmoq00640  Propanoate metabolism
lmoq00650  Butanoate metabolism
lmoq00900  Terpenoid backbone biosynthesis
lmoq01100  Metabolic pathways
lmoq01110  Biosynthesis of secondary metabolites
lmoq01120  Microbial metabolism in diverse environments
lmoq01130  Biosynthesis of antibiotics
lmoq01200  Carbon metabolism
lmoq01212  Fatty acid metabolism
lmoq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LM6179_2158 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LM6179_2158 (atoB)
   00640 Propanoate metabolism
    LM6179_2158 (atoB)
   00650 Butanoate metabolism
    LM6179_2158 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LM6179_2158 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LM6179_2158 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LM6179_2158 (atoB)
   00310 Lysine degradation
    LM6179_2158 (atoB)
   00380 Tryptophan metabolism
    LM6179_2158 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM6179_2158 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LM6179_2158 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LM6179_2158 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoq04147]
    LM6179_2158 (atoB)
Enzymes [BR:lmoq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LM6179_2158 (atoB)
Exosome [BR:lmoq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM6179_2158 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM20416
Position
complement(2058639..2059808)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system