KEGG   Listeria monocytogenes 6179 (serotype 1/2a): LM6179_2646Help
Entry
LM6179_2646       CDS       T03159                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lmoq  Listeria monocytogenes 6179 (serotype 1/2a)
Pathway
lmoq00670  One carbon pool by folate
lmoq01100  Metabolic pathways
lmoq01120  Microbial metabolism in diverse environments
lmoq01200  Carbon metabolism
Module
lmoq_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmoq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LM6179_2646 (fhs)
Enzymes [BR:lmoq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LM6179_2646 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CDM20894
Position
complement(2566299..2567981)
Genome map
AA seq 560 aa AA seqDB search
MSNKVKSDIEIASKAEILPVTTIAEHLGLDADALELYGKYKAKLSYDTIHSLKDKEPGKL
VLVTAINPTPAGEGKSTVTVGLGDALSKKDKKTVIALREPSLGPTMGIKGGATGGGYAQV
IPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGNDLEIDGRRIVWKRVVDLNDRALRK
VVVGLGGPIQGVPREDGFDITVASEIMAIICLASDLKDLKKRLSEIVIGYNYKKEPITVG
EMGYEGALTLLLKDALKPNLVQTLEHTPAIVHGGPFANIAHGCNSVSATSTALRLGDYVV
TEAGFGADLGAEKFLDIKVPALGKAPDCVVIVATIRALKMHGGALKTELSEENVDALSKG
FTNLQKHTESIQTFGIPYVVAINKFITDSDAEVAKLEALCEEHGIPFSLTEVWEKGGDGG
LELADKVIAAVESGAADYKRIYDDAWSMEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKK
YGWDRYPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLP
KKPAALNMDVDENGNAQGLF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaagtgaaatcagatattgaaattgcatcaaaagcagaaattctaccagtt
acgactattgcggaacatttaggactagacgcagatgcactcgaactttacggaaagtat
aaagcaaagttatcctatgataccattcactcgctaaaagacaaagaacctggaaaactt
gtccttgtaacagcaattaatccaacgcctgctggtgaaggaaaatcgactgtgacagtt
ggtcttggcgacgcactctctaaaaaagataaaaagactgttatcgcactgcgcgaacca
tcacttggacctactatggggattaaaggcggggcaactggtggcggctatgcgcaagtt
attccaatggaagatattaatttacactttacaggcgattttcatgcaattacagcagcg
aacaatgctttatcggcatttattgataaccatatgcaacaagggaatgacttagaaatt
gacggtagaagaatcgtttggaaacgtgtggttgatttgaacgaccgtgcgcttcgaaaa
gtagtggttggtctaggtggtcctattcaaggggttccacgtgaggatggttttgatatt
acagttgcttctgaaatcatggcgatcatttgtttagcaagtgatttaaaagatttaaag
aaacgcttaagcgaaattgtcatcggttataactataaaaaagaaccaattacggttggt
gaaatgggttacgaaggcgcattaacgttgttgttaaaggatgctttaaaacctaatttg
gtgcaaacattagaacatactcctgccatcgtacacggcggaccttttgcaaatattgct
cacgggtgtaatagtgtttctgcgacaagtacagcacttcgactaggtgattatgtagtg
acagaagctggatttggcgcagaccttggtgcagagaaatttttagatattaaagttcct
gcccttggaaaagctccagattgcgttgttattgtagcaacgattcgcgcactgaaaatg
cacggtggcgctttaaaaacagagctaagcgaggaaaatgtcgatgcgctatctaaaggc
tttactaacttacaaaaacatacggaatcaattcaaacatttggtattccttatgtggta
gcaattaataaatttatcactgattctgacgcggaagtagcgaaattagaagcgctatgc
gaagaacacgggattcctttctccctgacagaagtttgggaaaaaggtggcgatggcggc
ctggaactcgcggataaagtaattgcggcagtggaaagcggcgcagcggactacaaacgt
atttatgatgatgcgtggtcgatggaagaaaaactagaagcgattgtgacgaaagtatac
ggcggtattggtgtggaactttctagcaaggcgcaaaaacaaatcgttgaattcaaaaaa
tatggttgggatcgttatccgatttgtatggcaaaaacacaatattcgttatcggatgat
ccgacgttgcttggtcgtccaactgatttcgtgattcatattcgcgaatttattccaaaa
cttggtgctggctttgttgttgctttaacaggtgacgtgatgacaatgccgggcttacca
aaaaaaccagcggcattaaatatggatgtcgatgaaaatggtaacgcgcaaggtttattt
taa

DBGET integrated database retrieval system