KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_0332Help
Entry
LMOSLCC7179_0332  CDS       T02224                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos00010  Glycolysis / Gluconeogenesis
lmos00051  Fructose and mannose metabolism
lmos00562  Inositol phosphate metabolism
lmos01100  Metabolic pathways
lmos01110  Biosynthesis of secondary metabolites
lmos01120  Microbial metabolism in diverse environments
lmos01130  Biosynthesis of antibiotics
lmos01200  Carbon metabolism
lmos01230  Biosynthesis of amino acids
Module
lmos_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmos_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_0332 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOSLCC7179_0332 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOSLCC7179_0332 (tpiA-1)
Enzymes [BR:lmos01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC7179_0332 (tpiA-1)
Exosome [BR:lmos04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC7179_0332 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOSLCC7179_0332 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOSLCC7179_0332 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY59538
Position
complement(366527..367291)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEISVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaaatttcg
gtagaatcaatcattgatctaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatcaaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaagcaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaagctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system