KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_1053Help
Entry
LMOSLCC7179_1053  CDS       T02224                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos00020  Citrate cycle (TCA cycle)
lmos00620  Pyruvate metabolism
lmos01100  Metabolic pathways
lmos01120  Microbial metabolism in diverse environments
lmos01200  Carbon metabolism
lmos01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMOSLCC7179_1053 (pycA)
   00620 Pyruvate metabolism
    LMOSLCC7179_1053 (pycA)
Enzymes [BR:lmos01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     LMOSLCC7179_1053 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 RnfC_N HlyD_3 PTS_EIIA_1 GCV_H ADH_zinc_N NQRA YqfD
Motif
Other DBs
NCBI-ProteinID: CBY60259
Structure
PDB: 

Position
1061919..1065359
Genome map
AA seq 1146 aa AA seqDB search
MNRIKKVLVANRGEIAIRVMRACTELKIKTVAIYSQEDTGSFHRYKSDEAYLVGAGKKPI
DAYLDIENIIEIAKESGADAIHPGYGFLSENIEFARRCEQEGIIFVGPKSKHLDMFGDKI
KAKEQALLADIPVIPGSNGPVAGIKEVEEFGEKNGYPLMIKASLGGGGRGMRVVESKEHV
KESFERASSEAKAAFGNDEVYVEKCVMNPKHIEVQILGDTHGNIVHLFERDCSIQRRHQK
VVEVAPCNAITSELRNRICDAAVKLMKNVDYINAGTVEFLVEGDDFYFIEVNPRVQVEHT
ITEMITGIDIVQSQLFIADGYALHDQLVAIPKQEDIHIHGSAIQSRITTEDPLNNFMPDT
GRVDTYRSTGGFGVRLDAGNGFQGTVVTPFYDSLLVKLCTWGMTFEQATRKMRRNLIEFR
IRGVKTNIPFLLNVVRHPDFASGNYNTSFIDTTPELFKFPHIRDRGTKTLRYIGNVTVNG
FPGIKHRDKPVYAEPRLPKIPYGSQISPGTKQILDAKGPEGVVDWVKKQEEVLLTDTTLR
DAHQSLLATRVRSKDIFQVADAMAHLLPNMFSFEMWGGATFDVAYRFLNEDPWVRLETLR
KQIPNVMFQMLLRGANAVGYKNYPDNVIREFVKQSAQSGVDVFRVFDSLNWIKGMEVSID
AVREAGKVVEAAICYTGDIDDDTRTKYTIDYYKDMAKELVAQGTHILGIKDMAGLLKPQA
AYRLIGELKDTVDVPIHLHTHDTSGNGIYTYAAAVSAGVDIVDVASSAMSGATSQPSMTG
LYYGLVNGNRQTNLDAQNSQIINHYWEDVRHYYKDFDNALNSPQTEVYIHEMPGGQYTNL
QQQAIAVGLGDRWDEVKEMYTVVNQMFGDIVKVTPSSKVVGDLALFMVQNELSEEDVYEK
GDTIDFPDSVIEFFMGEIGQPYGGFPEKLQKLVLKGRTPLTDRPGALMEPVNFVDVKAEL
KEKMGYEPTEKDVISYILYPKVFLDYQDMINKYGDVTVLDTPTFYKGMRLGETIEVELEK
GKILLIKLNSIGEPIADGTRVIYFELNGQPREINIQDMNVQSTVIARRKIDTTNPEHVGA
TMTGSVIQVVVKKGDSVKKGDPLLITEAMKMETTIQAPFDGEVSSIYVSDGDTIESGDLL
IEVNRI
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaattaaaaaagtattagtagcaaaccgcggagaaattgctatccgtgttatg
cgtgcgtgtactgaactcaaaatcaaaacagtggctatttattcacaagaagatactgga
agttttcaccggtataaatcagatgaagcttatctggttggagcagggaaaaagcctatt
gatgcgtatctagatatcgaaaacataatagagattgctaaagaatctggtgcagacgcg
attcatccgggatatggtttcttgtccgaaaacattgaatttgctcgtcgttgtgagcaa
gaaggcattattttcgttggtcctaaatcaaaacacctagatatgtttggtgacaaaatt
aaagcaaaagaacaagccctattagctgatattccagtaattccgggaagtaatggaccc
gtggctggtattaaagaagtagaagaatttggtgagaaaaacggttatccattaatgatt
aaagcttcccttggaggcggcggtcgtggtatgcgtgtcgtagaatcaaaagaacatgtc
aaagaaagctttgaacgcgcatcttcagaagcaaaagcagcattcggaaatgatgaagta
tatgtagaaaaatgtgtgatgaatccaaaacatattgaagtacaaattcttggtgacacc
catggaaacatcgttcatttattcgaacgtgattgttcaatacaacgacgtcatcaaaaa
gtagtagaagtagctccgtgtaatgcgattacttctgaactacgtaaccgaatctgtgat
gctgcagtaaaactaatgaaaaatgttgattatattaatgctggaacggttgaattttta
gttgaaggtgacgatttctactttatcgaagtaaatcctcgtgtccaagtggagcataca
attacagaaatgattactggtattgatatcgttcaatcacaattattcattgcagatggt
tatgcacttcacgaccaactagtagctattcctaagcaagaggatatccatattcacggt
tctgctattcaaagccgtattacaacggaagatccacttaataactttatgccagatact
ggtcgagtagatacgtatcgttccacaggtggttttggtgttcggttggatgctggtaac
ggcttccaaggaacagtagtaacaccattttatgattcattactagtaaaattatgtact
tggggaatgacatttgagcaagcaacgcgcaaaatgcgtcgtaacctgatcgaattccgt
atccgcggtgtcaaaacgaacattcctttcttattgaatgtagttcgtcatccagatttt
gcgagtggtaattacaatacaagctttatcgatacaactccggaactatttaaattccca
catattcgcgaccgtggtacgaaaacgttgcgttatattggtaatgtaactgttaatggt
ttcccaggaattaagcaccgtgataaacctgtttatgcagaaccacgtttgccaaaaatt
ccttatggttcgcaaatctctccaggaacaaaacaaattttggatgcaaaaggtccagaa
ggcgttgtcgactgggtgaaaaaacaagaagaagtacttttgacagatactacgcttcga
gatgcacatcaatctctacttgcgacacgtgttcgttcaaaagatatttttcaagtggca
gacgcaatggcacatttattaccaaatatgttctcatttgaaatgtggggaggggcgact
tttgacgtggcatatcgtttcctaaatgaagatccatgggtgcgcctagaaacacttaga
aaacaaattccaaatgtgatgttccaaatgttacttcgcggagctaatgcagttgggtat
aaaaactaccctgacaatgttatccgtgaattcgttaagcaatcagcacaatccggtgtc
gatgtattccgcgtgtttgacagcttaaactggatcaaaggcatggaagtgtccattgat
gctgttcgtgaagcagggaaggtcgtagaggctgctatctgctatacaggagatatcgat
gatgacacaagaacgaaatatacgattgattactataaagatatggcgaaagagctcgtt
gctcaaggtacgcatattttaggcattaaagatatggctggacttttaaaaccacaagca
gcttaccgtttaattggtgaattaaaagatacagtagatgttccaatccaccttcataca
catgacacaagcggcaacggtatttatacttacgcagcagcagtcagtgcaggagttgac
attgtggatgttgcatcaagcgcgatgagtggggctacaagccaaccaagtatgactggt
ctttactacggattagtgaatggtaaccgtcaaacgaacttagacgctcaaaattcccaa
atcattaatcattactgggaagatgtccgtcactattataaagactttgacaatgcgctt
aattcacctcaaacagaagtatacattcatgaaatgccaggtggtcaatatactaacctt
caacaacaagccattgcagttggacttggcgatcgttgggacgaagtgaaagaaatgtat
acagtggttaatcaaatgtttggtgatatcgttaaagtaacaccttcttccaaagttgtt
ggagacttggcgctattcatggttcaaaatgaattatccgaagaagatgtatatgaaaaa
ggcgataccattgatttcccagattccgttatcgaattctttatgggggaaattggtcaa
ccatacggcggcttcccagaaaaacttcaaaaactagtactcaaaggacgtacaccactt
acagatcgtccaggcgctttaatggagccagttaactttgttgatgtcaaagcagaatta
aaagaaaaaatgggttatgaaccaactgaaaaagatgtcatttcctatattttatatcca
aaagtgttcctagattatcaagatatgattaacaaatatggtgatgtaacagtccttgat
acaccgacattctataaaggaatgcgtttaggggaaacaatcgaagtagaacttgaaaaa
ggaaaaatccttttaatcaagctaaattccattggtgaaccaattgcggatggcacacgt
gttatctattttgaattgaatggacaaccacgtgagattaacatccaagatatgaacgtt
caatctactgttattgcacgccgtaagattgatacaactaaccctgaacatgttggagcg
acaatgacaggttcagtcattcaagttgttgtgaaaaaaggcgactctgtgaaaaaagga
gatccactactaatcacagaagcaatgaaaatggaaacaacgattcaagcgcctttcgat
ggagaagttagcagcatttatgtttctgacggcgatactatcgaatctggtgatctatta
attgaagtaaacagaatttaa

DBGET integrated database retrieval system