KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1800Help
Entry
LMOSLCC7179_1800  CDS       T02224                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos00230  Purine metabolism
lmos01100  Metabolic pathways
Module
lmos_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMOSLCC7179_1800 (gmk)
Enzymes [BR:lmos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMOSLCC7179_1800 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 NB-ARC AAA_16 AAA_33 AAA_29
Motif
Other DBs
NCBI-ProteinID: CBY61006
Structure
PDB: 

Position
complement(1845687..1846307)
Genome map
AA seq 206 aa AA seqDB search
MMTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSR
EVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGI
FIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKI
KGIVETEHLKTERVIHRYKKMLEGLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaaagga
actgttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttctatg
acaacgcgtcttccgcgtgaaggcgaacaagacggggtcgattattattttcgttcaaga
gaagtttttgaacaagctatcaaagacggaaaaatgttagaatatgcagagtacgtcggt
aattattacggcactccgcttgaatatgtcgaggaaaaacttgccgcaggagtggatatt
tttctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcgatgccagaaggaatt
ttcattttcttaacgccaccagatttatccgaactaaaaaaccggattatcggtcgcggc
acagaatcgatggaagttgtcgaggaacgcatggaaacagctaagaaagaaatcgaaatg
atggcgtcttatgattatgctgtggtgaatgatgttgtagcaaacgccgtacaaaaaatc
aaaggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaa
atgttggagggattacaatga

DBGET integrated database retrieval system