KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_1816Help
Entry
LMOSLCC7179_1816  CDS       T02224                                 

Gene name
rluD-2
Definition
(GenBank) ribosomal large subunit pseudouridine synthase, RluD subfamily
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lmos03009]
    LMOSLCC7179_1816 (rluD-2)
Enzymes [BR:lmos01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LMOSLCC7179_1816 (rluD-2)
Ribosome biogenesis [BR:lmos03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LMOSLCC7179_1816 (rluD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Phage_Cox
Motif
Other DBs
NCBI-ProteinID: CBY61022
Position
complement(1862731..1863642)
Genome map
AA seq 303 aa AA seqDB search
MQNETLIIEESHARERVDKVIAEMMGKSRSAIQLMLKNGDITVNGELAKPNYKVQVGDEI
HYEVREPEELEVLAEDIPLDIYFEDKDMLVVNKPEGMVVHPSAGHASGTLVNALLFHCDD
LSGINGKIRPGIVHRIDKDTSGLLMVAKNDHAHESLAKQLKDKTSDREYIALVHGDIVHQ
KGTIEAPIGRAKEDRQKMAVVRDGKEARTHFEVLERLPGYTLINCKLDTGRTHQIRVHLK
YIGHPLAGDPKYGPKNTIKGNGQFLHAAKLGFDHPTTNERMTFEAPLPSSFEKALKSLRQ
EEY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgaaacattgattatagaagaaagccacgcgcgcgaacgtgtggacaaagtg
attgctgaaatgatgggaaaaagtcgttcagcaatacaactcatgctgaaaaacggtgat
attacggttaatggagaacttgcgaagccaaattacaaagtacaagttggcgatgaaatt
cattacgaagtgcgtgaaccagaagaactagaagttttagcagaagatattccactagat
atatattttgaagataaagatatgcttgttgtaaataaacctgaaggaatggttgttcat
ccatctgcgggacatgcaagtggaacgctcgtgaatgctttactattccattgtgatgat
ttatctggaattaacggtaaaattcgtccaggtattgttcaccgaattgataaagataca
tctggcttattaatggttgccaaaaatgaccacgcccatgaatcattagccaaacaatta
aaagacaaaacttcggatagagaatatatcgcacttgtccacggtgatattgtccaccaa
aaaggaacaatcgaagcgccaatcggccgtgccaaagaagatcgtcaaaaaatggcagtc
gtacgcgatgggaaagaagcgagaacgcattttgaagtattagagcgcctaccaggttac
acattaattaattgcaaactagacactggacgtacgcaccaaatccgagttcatttgaaa
tatatcggtcatcctttagcaggagatccgaaatacggacctaaaaacacaatcaagggc
aatggccaatttctccatgccgcaaaattaggatttgatcatccgacaacgaatgaacga
atgacatttgaagcgccactaccaagttcatttgaaaaagctttaaaatcattacgtcaa
gaagaatattaa

DBGET integrated database retrieval system