KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2692Help
Entry
LMOSLCC7179_2692  CDS       T02224                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos00010  Glycolysis / Gluconeogenesis
lmos00620  Pyruvate metabolism
lmos00640  Propanoate metabolism
lmos00680  Methane metabolism
lmos01100  Metabolic pathways
lmos01110  Biosynthesis of secondary metabolites
lmos01120  Microbial metabolism in diverse environments
lmos01130  Biosynthesis of antibiotics
lmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_2692 (acsA)
   00620 Pyruvate metabolism
    LMOSLCC7179_2692 (acsA)
   00640 Propanoate metabolism
    LMOSLCC7179_2692 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC7179_2692 (acsA)
Enzymes [BR:lmos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOSLCC7179_2692 (acsA)
Lipid biosynthesis proteins [BR:lmos01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOSLCC7179_2692 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY61898
Position
2736896..2738473
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLRLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDVKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
AGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattactgacgagattgctaaa
tttagttctgaaaaaacagctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaacaaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tatatgggcttatggaaagctggtgccattattatcccggcatccgaactccttaaagca
cacgatttagaatatcgtatccaccacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggagataaattatctggatgggaacaatatgaaacattaatggaagctgctccaactgag
tttgaacgtgtagaaacctctcgcgatgacgcttgtctacttgctttcacaagtggaaca
acgggtaaccctaaaggtgttgtacatattcacggttggggttacgcgcatatccgtatc
gccgctgatcattggctcgatattcacgaagacgatatcgtttgggccacagctggtccg
ggttggcaaaaatgggtttggtctcccttcctttctgtacttggaaaaggcgcgactggc
ttcatttacaacggtcgttttattcctgaaaaacaacttcgtttactggaagaagaaaaa
atcaacgtgctatgctgtacgccaacagaatatcgtttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagtgccgtatcagcaggagaacctttaaaccgc
gaagttattcaagttttccaagacaattttgacgttaaagttcgtgacggttacggccaa
acggagagcacgcttttgattgggacgcttgttgatacgccgattcgccctggttcgatg
ggcaaaccgattatgccagaatatatggcgattattgatgctgacggcaatccggtcggt
gctggtgagattggcgacatcgcgatgcgtagagacttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattattttgtttctggtgac
cgagctatccgcgatgaagacaattactactggttccaagggcggaatgacgatattatt
attagttcgggttacacgattggaccgttcgaagtagaggacgcactcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagccctgacgaaatccgcggaacggtcgtaaaa
gcgtttatcgtcttaaaggatggttacgagggcaccgaggatcttgtgcatgaattacaa
acatttacgaaagaacaaactgctccgtataaatatccacgccggattgagtttgttgaa
gcgttaccgaaaactgattctggtaaaattcgccgcgttgagttgcgtgatgcggagttt
gctagtgtacacggataa

DBGET integrated database retrieval system