KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_1492Help
Entry
LMOSLCC2540_1492  CDS       T02242                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmot  Listeria monocytogenes SLCC2540 (serotype 3b)
Pathway
lmot00071  Fatty acid degradation
lmot00072  Synthesis and degradation of ketone bodies
lmot00280  Valine, leucine and isoleucine degradation
lmot00310  Lysine degradation
lmot00362  Benzoate degradation
lmot00380  Tryptophan metabolism
lmot00620  Pyruvate metabolism
lmot00630  Glyoxylate and dicarboxylate metabolism
lmot00640  Propanoate metabolism
lmot00650  Butanoate metabolism
lmot00900  Terpenoid backbone biosynthesis
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01120  Microbial metabolism in diverse environments
lmot01130  Biosynthesis of antibiotics
lmot01200  Carbon metabolism
lmot01212  Fatty acid metabolism
lmot02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2540_1492
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC2540_1492
   00640 Propanoate metabolism
    LMOSLCC2540_1492
   00650 Butanoate metabolism
    LMOSLCC2540_1492
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC2540_1492
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC2540_1492
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC2540_1492
   00310 Lysine degradation
    LMOSLCC2540_1492
   00380 Tryptophan metabolism
    LMOSLCC2540_1492
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2540_1492
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC2540_1492
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC2540_1492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmot04147]
    LMOSLCC2540_1492
Enzymes [BR:lmot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC2540_1492
Exosome [BR:lmot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2540_1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY76133
Position
complement(1474487..1475656)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATVLKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgttctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system