KEGG   Listeria monocytogenes SLCC2540 (serotype 3b): LMOSLCC2540_1958Help
Entry
LMOSLCC2540_1958  CDS       T02242                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lmot  Listeria monocytogenes SLCC2540 (serotype 3b)
Pathway
lmot00670  One carbon pool by folate
lmot01100  Metabolic pathways
lmot01120  Microbial metabolism in diverse environments
lmot01200  Carbon metabolism
Module
lmot_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LMOSLCC2540_1958 (fhs)
Enzymes [BR:lmot01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LMOSLCC2540_1958 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CBY76599
Position
complement(1980614..1982296)
Genome map
AA seq 560 aa AA seqDB search
MSNKVKSDIEIASKAEILPVTTIAEHLGLDADALELYGKYKAKLSYDTIHSLKDKEPGKL
VLVTAINPTPAGEGKSTVTVGLGDALSKKDKKTVIALREPSLGPTMGIKGGATGGGYAQV
IPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGNDLDIDGRRIVWKRVVDLNDRALRK
VVVGLGGPIQGVPREDGFDITVASEIMAIICLASDLKDLKKRLSEIVIGYNYKKEPITVG
EMGYEGALTLLLKDALKPNLVQTLEHTPAIVHGGPFANIAHGCNSVSATSTALRLGEYVV
TEAGFGADLGAEKFLDIKVPALGKAPDCVVIVATIRALKMHGGALKTELSEENVDALAKG
FTNLQKHTESIQTFGIPYVVAINKFITDSDVEVAKLEALCKEHGIPFSLTEVWEKGGDGG
LELADKVIAAVESGEADYKRIYDDAWSMEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKK
YGWDRYPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLP
KKPAALNMDVDENGNAQGLF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaagtgaaatcagatattgaaattgcatcaaaagcagaaattctaccagtt
acgactattgcggaacatttaggactagacgcagatgcactcgaactttacggaaagtat
aaagcaaagttatcctatgataccattcactcgctaaaagataaagaaccaggaaaactt
gttcttgttacggcgattaacccaacgcctgctggtgaagggaaatcgacagtgacagtt
ggtcttggcgacgcactctctaaaaaagataagaaaaccgttattgcacttcgcgaacca
tcgctcggacctaccatgggtattaagggcggggcaacaggtggcggatacgcgcaggtt
attccaatggaagatattaatttacattttactggtgatttccacgcaattacagcagct
aataatgctttatcggcatttattgataaccatatgcaacaagggaatgacctagatatt
gacggtagaagaatcgtttggaaacgtgtagttgatttgaacgaccgtgcacttcgaaaa
gtggttgttggtcttggaggtcctattcaaggggttccacgtgaagacggttttgatatt
acggttgcttctgaaattatggcgatcatttgtttagcaagtgatttaaaagatttaaag
aaacgtttaagtgaaatcgtgatcggttataactataaaaaagaaccaattacagttggc
gaaatgggctacgaaggcgctctaaccttactattaaaagatgctttaaaacctaattta
gtgcaaacattagaacatacacctgccatcgtacacggtggaccttttgcgaatattgct
cacggatgtaatagtgtttctgcgacaagcacagcacttcgactaggtgagtatgtagtg
acagaggctggatttggtgcagaccttggtgccgagaaatttttagatattaaagttcct
gcccttggaaaagcgccagattgcgttgttattgtagcaacgattcgcgcactgaaaatg
cacggtggcgctttgaaaaccgagcttagcgaagaaaatgtggatgcgctagctaaaggt
tttacgaatttacaaaaacataccgaatctattcaaacatttggtattccttatgtcgta
gccattaataaattcattaccgattctgacgtagaagtagcgaaattagaagcgctctgc
aaagaacacgggattcctttctctctgacagaagtttgggaaaaaggcggcgacggtggc
cttgaactcgcggataaagtcattgcggctgttgaaagtggcgaagcggactacaaacgt
atttatgatgatgcgtggtcgatggaagaaaaactagaagcgattgtgacgaaagtatac
ggcggtattggtgtggaactttccagcaaggcgcagaaacaaatcgttgaattcaaaaaa
tatggttgggaccgctatccgatttgtatggcgaaaacccaatattccttatcggatgac
ccaacattacttggacgcccaactgattttgttattcacattcgcgaattcattccaaaa
cttggtgctggttttgtcgttgctttaacaggcgatgtaatgacgatgccaggtttaccg
aaaaaaccagcggcacttaatatggatgtcgatgaaaatgggaatgcacaaggtttattt
taa

DBGET integrated database retrieval system