KEGG   Listeria monocytogenes WSLC1001 (serotype 1/2a): AX10_01150Help
Entry
AX10_01150        CDS       T03114                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmow  Listeria monocytogenes WSLC1001 (serotype 1/2a)
Pathway
lmow00071  Fatty acid degradation
lmow00072  Synthesis and degradation of ketone bodies
lmow00280  Valine, leucine and isoleucine degradation
lmow00310  Lysine degradation
lmow00362  Benzoate degradation
lmow00380  Tryptophan metabolism
lmow00620  Pyruvate metabolism
lmow00630  Glyoxylate and dicarboxylate metabolism
lmow00640  Propanoate metabolism
lmow00650  Butanoate metabolism
lmow00900  Terpenoid backbone biosynthesis
lmow01100  Metabolic pathways
lmow01110  Biosynthesis of secondary metabolites
lmow01120  Microbial metabolism in diverse environments
lmow01130  Biosynthesis of antibiotics
lmow01200  Carbon metabolism
lmow01212  Fatty acid metabolism
lmow02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX10_01150
   00630 Glyoxylate and dicarboxylate metabolism
    AX10_01150
   00640 Propanoate metabolism
    AX10_01150
   00650 Butanoate metabolism
    AX10_01150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX10_01150
   00072 Synthesis and degradation of ketone bodies
    AX10_01150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX10_01150
   00310 Lysine degradation
    AX10_01150
   00380 Tryptophan metabolism
    AX10_01150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AX10_01150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AX10_01150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AX10_01150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmow04147]
    AX10_01150
Enzymes [BR:lmow01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AX10_01150
Exosome [BR:lmow04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AX10_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ03127
Position
complement(213707..214876)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system