KEGG   Listeria monocytogenes WSLC1001 (serotype 1/2a): AX10_01990Help
Entry
AX10_01990        CDS       T03114                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmow  Listeria monocytogenes WSLC1001 (serotype 1/2a)
Pathway
lmow00430  Taurine and hypotaurine metabolism
lmow00620  Pyruvate metabolism
lmow00640  Propanoate metabolism
lmow00680  Methane metabolism
lmow01100  Metabolic pathways
lmow01120  Microbial metabolism in diverse environments
lmow01200  Carbon metabolism
Module
lmow_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX10_01990
   00640 Propanoate metabolism
    AX10_01990
  09102 Energy metabolism
   00680 Methane metabolism
    AX10_01990
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AX10_01990
Enzymes [BR:lmow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AX10_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AHJ03293
Position
complement(392925..394118)
Genome map
AA seq 397 aa AA seqDB search
MEKTIAINAGSSSLKFQLYDMPSERVITAGIVERIGLKDSIFTITVDGKKIKEIIDIPDH
EIAVQMLLEKLINHKVIGSYDEITGIGHRVVHGGERFPESVYIDDQVIKDIEALSELAPL
HNPANVTGIKAFRKILPDVVSVAVFDTAFHQTMPPASYLYSLPYSYYEDYGIRKYGFHGT
SHKYVSERAAELLGRPVEELRLLTCHLGNGASIAAIEGGKSMDTSMGFTPLAGVSMGTRS
GNIDPALIPFIMEKTGKTAEQVLDVLNKESGMLGVSGISSDLRDLEDEAAKGNDRAELAL
QVFVDRIHKYIGSYAARMNGVDAIIFTAGIGENSSYIREKVLRGLEFMGVYWDPALNQVR
GEERFLNYPHSPVKVIIIPTNEELMIARDVETIKNNR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacgattgcaattaacgccggaagttcttcactgaaattccaattatatgat
atgccatctgaacgtgttatcacagcagggattgtagaaagaattggtttgaaagattct
atttttacaattactgtagacggaaaaaaaatcaaagaaattattgatattcctgaccat
gaaattgctgttcaaatgctacttgaaaaattaattaaccacaaagttatcggttcttac
gatgaaatcactggaattggtcaccgcgttgttcacggtggagaaagattccctgaatcc
gtttatattgatgaccaagtaattaaagatattgaagctctatctgaacttgcaccgctt
cataacccagcgaacgttactggtattaaagcattccgcaagattttaccagacgttgtt
tcagtggctgttttcgatacagctttccatcaaacaatgcctccagcaagttatctttac
agcctgccatacagctattatgaagactatggtatccgtaaatacggtttccacggtaca
agtcacaaatatgtatccgaacgcgctgcagaacttttaggacgtcctgtagaagaatta
cgtttactaacttgtcaccttggtaatggtgctagtatcgctgcaatcgaaggcggaaaa
tcaatggacacttccatgggattcacaccactagctggtgtttctatgggaactcgttct
ggtaacattgaccctgcgcttattcctttcatcatggaaaaaactggtaaaactgcagaa
caagtacttgatgtgttaaacaaagaatctggtatgcttggcgtatctggtatttcaagc
gaccttcgtgatttagaagatgaagcagcaaaaggaaacgaccgcgcggaacttgcactt
caagttttcgttgaccgtatccataaatacattggttcttatgcagctcgcatgaacggt
gtagatgccattatcttcacagctggtatcggtgaaaatagttcatacatccgtgaaaaa
gtacttcgtggacttgaattcatgggcgtatactgggatccagcacttaaccaagtgcgc
ggagaagaaagattccttaactacccacattccccagtaaaagttatcatcattcctaca
aacgaagaattaatgattgctcgtgatgtagaaacaattaaaaataatcgctaa

DBGET integrated database retrieval system