KEGG   Listeria monocytogenes WSLC1001 (serotype 1/2a): AX10_04420Help
Entry
AX10_04420        CDS       T03114                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lmow  Listeria monocytogenes WSLC1001 (serotype 1/2a)
Pathway
lmow00471  D-Glutamine and D-glutamate metabolism
lmow00550  Peptidoglycan biosynthesis
lmow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmow00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AX10_04420 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AX10_04420 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmow01011]
    AX10_04420 (murD)
Enzymes [BR:lmow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     AX10_04420 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lmow01011]
 Precursor biosynthesis
  Amino acid ligase
   AX10_04420 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHJ03746
Position
complement(884280..885647)
Genome map
AA seq 455 aa AA seqDB search
MKKIEMYHHKKVLVLGLARSGVSAATIMHKLGAFVTVNDQKPFSENPEAQGLLEQGIKVI
CGSHPIELLDEGFELVIKNPGIPYNNPMIEKALKLKIPVITEVELAYQISEAPIVGITGT
NGKTTTTTIIHHMLNAHKENSSLLAGNIGFPASAVAENATSDQYISMELSSFQLMGVETF
KPHISVITNIYEAHLDYHTDRSEYVQAKWHIQKNQTADDFLVINWDQEELKNLTKQTKAQ
VIPFSTTQRLGQGSYVQNGNIMFNDEVIGERDNILLPGEHNLENVLASVAVAKTLGVTNE
EIMHVLETFKGVEHRTQFVVEWQGRKFYNDSKATNILATQSALKGFKNPVVLLAGGLDRG
NSFDELLPFFKNVKTLIVFGETADKIGRVGKIAGIEVHYVDNVEAAVPVAYRESAPGDII
LLSPACASWDQYRTFEVRGNAYMDAIGELIEEVEK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaaatgtaccatcacaaaaaagtacttgtcttgggtcttgcaagaagt
ggtgttagcgcggcaacaattatgcataaactgggagcatttgtaactgttaatgatcaa
aaaccttttagcgagaatccagaagcgcaaggtttacttgagcaaggtattaaagttatt
tgcggttcgcacccaattgaacttttggatgagggatttgagcttgttataaaaaacccc
ggaattccgtacaataacccaatgattgaaaaagcgttaaaacttaaaattccagtcatt
acggaagtggaattagcttaccaaatttctgaggcaccgattgttggaatcacaggaaca
aatggtaaaacaacgacaacaacgattattcaccatatgttaaatgcacataaagaaaat
agttctttactagcagggaacattggttttccagcatccgctgttgctgaaaatgcaaca
agtgatcaatatatttcgatggaactatcttcgttccaattaatgggcgtagaaacgttt
aaaccacatatttccgttattacgaatatttatgaggcacatttagactaccatacagac
cgtagcgaatacgtccaagcaaaatggcacatccaaaaaaatcaaacagcggatgatttc
ttagtaattaactgggatcaagaagagcttaaaaatttaacaaaacaaacaaaagcgcaa
gttattcctttttcaacaacgcaacgtcttggtcaaggaagctacgtgcaaaatggcaat
attatgttcaacgacgaagtgattggggagcgtgacaatattttacttcctggagaacat
aacttagaaaacgtacttgcttccgtagcagtagcaaagacattaggtgttacaaacgaa
gaaatcatgcacgtattagaaacatttaaaggtgtagagcaccggacacaatttgttgta
gaatggcaaggtcgtaaattctataacgattcaaaagcaacgaatatccttgcaactcaa
agtgcattaaaagggtttaaaaatccagttgtgttactcgctggtggtttggaccgtggt
aattcatttgacgaattactaccatttttcaaaaatgtaaaaacgttaatcgtctttggc
gaaacagcagataaaattggtcgtgtcgggaaaatcgctggtattgaagtacattacgtg
gataatgtcgaagcggcagttcctgttgcttatcgcgaatcagcgccaggagatattatc
ttactttcaccagcatgtgcgagttgggatcaataccggacatttgaagttcgcgggaat
gcctacatggatgcaatcggtgaactaatagaagaggtggaaaaatga

DBGET integrated database retrieval system