KEGG   Listeria monocytogenes WSLC1042 (serotype 4b): AX24_04555Help
Entry
AX24_04555        CDS       T03151                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmox  Listeria monocytogenes WSLC1042 (serotype 4b)
Pathway
lmox00071  Fatty acid degradation
lmox00072  Synthesis and degradation of ketone bodies
lmox00280  Valine, leucine and isoleucine degradation
lmox00310  Lysine degradation
lmox00362  Benzoate degradation
lmox00380  Tryptophan metabolism
lmox00620  Pyruvate metabolism
lmox00630  Glyoxylate and dicarboxylate metabolism
lmox00640  Propanoate metabolism
lmox00650  Butanoate metabolism
lmox00900  Terpenoid backbone biosynthesis
lmox01100  Metabolic pathways
lmox01110  Biosynthesis of secondary metabolites
lmox01120  Microbial metabolism in diverse environments
lmox01130  Biosynthesis of antibiotics
lmox01200  Carbon metabolism
lmox01212  Fatty acid metabolism
lmox02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX24_04555
   00630 Glyoxylate and dicarboxylate metabolism
    AX24_04555
   00640 Propanoate metabolism
    AX24_04555
   00650 Butanoate metabolism
    AX24_04555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX24_04555
   00072 Synthesis and degradation of ketone bodies
    AX24_04555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX24_04555
   00310 Lysine degradation
    AX24_04555
   00380 Tryptophan metabolism
    AX24_04555
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AX24_04555
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AX24_04555
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AX24_04555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmox04147]
    AX24_04555
Enzymes [BR:lmox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AX24_04555
Exosome [BR:lmox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AX24_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHJ35480
Position
complement(833319..834488)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system