KEGG   Listeria monocytogenes WSLC1042 (serotype 4b): AX24_14350Help
Entry
AX24_14350        CDS       T03151                                 

Definition
(GenBank) transcriptional regulator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lmox  Listeria monocytogenes WSLC1042 (serotype 4b)
Pathway
lmox00730  Thiamine metabolism
lmox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AX24_14350
Enzymes [BR:lmox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     AX24_14350
Transcription factors [BR:lmox03000]
 Prokaryotic type
  Other transcription factors
   Others
    AX24_14350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NOG1_N
Motif
Other DBs
NCBI-ProteinID: AHJ37224
Position
2704260..2704934
Genome map
AA seq 224 aa AA seqDB search
MFVHGFQEEVGDLWQETLQHPFVQSLADGTLEKEAFYYYLLQDDYYLSHFEKVIEKSVEQ
AGTAELAAEMREVQRRLQQSELLMREQFYPRVGLAERDFSERKPAPTAYHYTSHLYRMAD
FGSFGVTIAALLPCYALYADMGKMYEGARSSEPFYQELLDSYVDENYQKVVLQQKRLVEQ
AASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVNYV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttcacggttttcaagaagaagtaggggatttatggcaagaaacgttgcagcat
ccatttgtgcagagtttggcggatgggacgcttgagaaggaggcgttttactattatttg
ctccaggatgattattacttgtcacattttgagaaggtgattgagaaaagtgtggaacag
gcggggacggcggaacttgctgcggaaatgagggaagtacaaaggcggcttcagcaatca
gagttgttgatgcgcgaacagttttatccacgggttgggctagcggagcgtgatttttcc
gagcgcaaaccagcgccaactgcttatcattatacttctcacctttaccggatggcagat
tttggcagttttggggtaacgattgcggcgcttttgccatgttatgcgctttatgcggat
atggggaaaatgtacgaaggggcgcggagttcggagccattttatcaagagttgttggat
agttatgtggatgaaaattatcaaaaagtggtgttgcagcagaagcggttggtggaacag
gcggcgagtatggcggatgcgcgggagcttgccctcatgaagcaggcttttcaaattagt
gtggaaatggaatgggcattttttgatatggcttataaaaaacaaaattggcgtgggagt
gtgaattatgtttga

DBGET integrated database retrieval system