KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0056Help
Entry
LMOSLCC2479_0056  CDS       T02241                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Pathway
lmoy00230  Purine metabolism
lmoy00250  Alanine, aspartate and glutamate metabolism
lmoy01100  Metabolic pathways
Module
lmoy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LMOSLCC2479_0056 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2479_0056 (purA)
Enzymes [BR:lmoy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     LMOSLCC2479_0056 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CBY56327
Position
58897..60189
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKFDGVTYKLHLIPSGIF
YKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHIILPYHIRIDEADEERK
GANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHNLGEKNRLLERFYELEGF
KLEDILDEYYEYGQQFKEYVCDTSVVLNDALDDGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTELFDSIGDTIREVGHEYGTTT
GRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETLKICVAYKLDGKTITEFPASL
KDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMERIAQLTGVQVSMFSVGPDRAQT
HVIKSVWRLA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttgttgtagtaggaacacagtggggcgatgaaggaaaagggaagattacg
gattttctttccgagaatgcagaagcgattgctagatatcaaggtgggaacaatgcaggt
catacaattaagtttgatggcgtaacgtacaaattacacttaattccatcaggtatcttt
tacaaagaaaaaattagtgttattggtaacggtatggttgttgatccaaaggctttagtg
gaggaattaaaatatcttcatgataaaggtgtggatacttctaatttgcgtatttctaac
cgtgcgcacattattttaccatatcacattcgtattgatgaagctgacgaagaacgtaag
ggcgcaaacaaaatcggtacaacgaaaaaaggtatcggcccagcttacatggataaagca
gcgcgtgtaggcattcgtattattgatttattagataaagaaacatttaaagagaaatta
gagcataatcttggcgagaaaaaccgtttattagaacgtttttacgaacttgaaggcttt
aaactagaagatattttagacgagtactatgaatatggtcaacaatttaaagaatatgtt
tgcgatacatcggttgttttaaatgacgctttagatgatggtaaacgtgtgttatttgaa
ggtgcgcaaggggttatgcttgatattgatcaaggaacatatccatttgtaacttcaagt
aacccgattgctggtggcgtaactatcggtagtggtgttggtccttcaaaaatcaatcat
gttgttggtgtggcgaaagcttatacaacacgtgttggtgatggtcctttcccaacagaa
ttatttgattctattggtgacactattcgtgaagtcggtcatgaatatggtacaacgact
ggtcgtccgcgtcgtgtaggttggtttgatagcgtagtggttcgtcatgcgcgtcgtgtt
agtggattaacagatttatcgttaacactacttgatgttttgacaggaattgagacactt
aaaatctgtgtagcttacaaattagacggaaaaacaattacagagttcccagcaagtttg
aaagatttagctcgttgcgaacctgtttatgaagaacttccaggctggacggaagatatt
actggagttacatcactagatgatcttccagtgaactgccgccattacatggagcgtatc
gcccaacttacgggtgtgcaagtttctatgttctctgtaggccctgaccgcgctcaaaca
catgttattaaaagcgtttggcgtttagcttaa

DBGET integrated database retrieval system