KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0164Help
Entry
LMOSLCC2479_0164  CDS       T02241                                 

Definition
(GenBank) hypothetical protein
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_10 UPF0020 Methyltransf_31 Cons_hypoth95 Methyltransf_11 PrmA DUF43 Methyltransf_18 N6_Mtase N6-adenineMlase Methyltransf_32 Methyltransf_16 Met_10 DOT1 PCMT Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: CBY56435
Structure
PDB: 

Position
164705..165478
Genome map
AA seq 257 aa AA seqDB search
MLEKVNHLEKLKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFSYLPVRKGKIID
LCSGNGIIPLLLSTRTEAQIVGVEIQERLADMAKRSISYNQLEEQIEMIEYDLKNITDLI
PKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVAASLLKQGGKANFV
HRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVLVEGIKDGKPGVKYVPPVIVYDE
LGEYTPVIKEILYGESE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgctagaaaaggtgaatcatttggaaaaactcaaattaataggtgatgaaagactggat
tatttattagcagaaaatttgcggattattcaaagcccatcggtattttctttctcgata
gatgcagttctcctagcgaaattcagttatttgcctgtgcgtaaggggaaaataattgat
ttatgtagcgggaatgggattatccctttattacttagcacgcgaactgaagcgcaaata
gttggtgttgaaattcaggagcgcctggcagatatggcgaaaagaagcatttcgtataat
caattagaagagcaaattgaaatgatcgaatatgatttgaaaaatattacagatcttatt
ccaaaagagcgcgcggatattgtcacctgtaatccaccttatttcgcaaccccggataca
agtttgaaaaataccaatgaacattttcggattgctcgccatgaagtaatgtgcacgtta
gaagatactattcgtgtagcagcaagccttttaaaacaagggggaaaagcgaattttgtt
catcgtccggaacgattactagatatcattgatataatgagaaaatatcgcttagagccg
aaacgcattcaattcgttcatccgcgcatagataaagaagcgaatacggtgcttgtggaa
ggaattaaagatggaaaacctggtgtaaaatatgtaccacctgttatcgtatatgatgaa
cttggagaatatactccagtaattaaggagattttatatggcgaaagcgagtga

DBGET integrated database retrieval system