KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0170Help
Entry
LMOSLCC2479_0170  CDS       T02241                                 

Definition
(GenBank) leucine-rich repeat domain protein (LPXTG motif)
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_adjacent MucBP DUF5011 LRR_4 Big_3 LRR_8 MucBP_2 Gram_pos_anchor LRR_9 DUF4625 PKD HYR Big_4
Motif
Other DBs
NCBI-ProteinID: CBY56441
Position
169480..171978
Genome map
AA seq 832 aa AA seqDB search
MRKIPVVVSLALCFSLVSPSLYASADTITAVQITKEATTDTTEPTTIDQPSRMDNSQTAP
QKMTASSSEEAATTNSTEEENTPKNNLKSTSENSKTYAELFPDVNLAKIIAKNISGTEDI
NAEVSEAELQTITNLVATNQNITSLTGIEHLTALENINVNNNELTTIDSLFNIPTLKSIN
ANNNKITGNFSLVKTLPELHTLEVLGNAITELDIENQPNLVTLSADELELKKLTLKNLSQ
LNGLGRIASSISIDWGDLESVTLMNLPEIISVDISGNYLDSDDIHLENLPAVKNLDISSN
ELTRLPKINDFPLLTTINVRSNKIDRLESSKLVDVPKLATLNADKQAVTLSKTIAAGNFT
IPNNVENLAGQMVTPKIISNNGTYSDQSIAWASGELSGLSKVSYTFDEVINSPAIAGKYT
GTVNQPIEVKAVPVIVADKSVSYAPVNAKDEATFLQDIRASASENAQITSDYSEVVDFAT
PGDYTVTLHAKNEFDLKADPVTVVVHINDIQKPQVAVNSNDISFEVGTELTSEVLLAKSG
AVVTDLYDEAIKMEVDLSEVDSSKLGTYEATIIAKSKSGASSDPIKLSVKIVDTEKPIIQ
INNPEIIIEKGSELTEGQIIDQVGITATDNYDQDLNIHMDLSKVDTSKPGSYEVTIYTED
SSGNRSETVTITVKVPEARIGKITIQYMDSENNELAESNTITGEVGETYETLAKEIEGYT
LKENPANSSGVFEETRQTIQYIYVKDIINPEFPVYSENNVTPELPSNNNNSVNGSRQTPS
KSVKKQSKAYSKINQMPMNLPETGDSTNLLFIFMGVLLLAGLTLSKAKRKNQ
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaataccagttgttgtttctcttgctttgtgttttagcctagtaagtcctagt
ttgtatgctagtgcagatactataactgcggtccaaatcactaaggaagcaacaaccgac
actacagaacctacaactattgaccagcctagcagaatggacaactcgcaaaccgcacca
cagaaaatgacagcatcatccagtgaagaagctgcaactactaactcaactgaagaggaa
aatacacctaaaaataatttgaaatcaacttctgaaaacagcaaaacatatgctgaacta
tttccggatgttaatttagccaaaataatagctaaaaatattagtggaacagaagatatt
aatgcagaagtatcagaagcagaattacaaactattactaatttagtagcaacaaaccag
aatattacgagcttaactggcatagagcatttaacagcgttagaaaatatcaatgtgaac
aacaatgagctcacgacaatagattcgttatttaatataccaaccttaaaatcaattaac
gcgaataataataaaataacggggaattttagtttggtaaaaactttgccggaattacac
acgttagaagtgcttggtaatgcaattacagagttagatattgaaaaccaacctaaccta
gtaactttgtcggcagatgaattagaattgaaaaagctaacgttgaaaaatttatcccaa
ttaaacggactaggaagaatagcttccagtatttctattgactggggtgatctagagagc
gtcactttaatgaatttaccagaaataataagcgtagatattagtgggaattatttagac
agtgatgatatacatttggagaaccttcctgcagttaagaacctggatatcagtagtaat
gaactaactcggctaccgaaaattaacgattttccgcttctgactacaattaatgtaaga
agtaataaaatagataggctagaatcaagtaaactagtcgatgtaccaaaacttgcgaca
ctaaatgcggataaacaagccgttacgctttcaaaaacgatagcagcagggaactttacg
ataccgaataacgttgagaacttagcgggacaaatggttacaccgaaaataatttccaac
aacggaacttactctgatcaaagcatcgcatgggcaagcggagaactatcaggcttatca
aaagtttcttatacatttgatgaagtgattaatagtccggcaattgctggcaagtacact
ggaacagtaaaccaaccaattgaagtcaaggcagtacctgtaattgtagcggataagagt
gtttcgtacgcgcccgtaaatgcaaaagatgaggcgacatttttacaagatattcgtgcg
tctgcttcggaaaacgcacagattactagcgattatagcgaggtagtcgactttgcaact
ccgggagattatacagtcacgctacatgctaaaaatgagtttgacttaaaggcagatccg
gttaccgttgtcgtgcatattaatgatattcaaaaaccacaagtcgcggttaactcgaac
gatatttcatttgaagtaggaacagaattaactagtgaagtgcttcttgctaaatctggc
gcggtagttacggatctatacgacgaagcaattaagatggaagttgacttgtccgaagtg
gattcaagcaaacttggaacgtatgaagcgacgataatagcaaaaagcaaaagtggtgct
tcctcggatccaatcaaactttctgttaaaatagtcgataccgaaaaacctattattcaa
attaacaatccggaaataattattgaaaaaggcagcgaattaacagagggtcaaatcatt
gaccaagttggaataactgcaacagataattatgatcaagatttaaatatccacatggat
ttatctaaagtagatacttccaagccaggcagttatgaagtaaccatttatacagaagat
tcatctggtaatcgttcagaaacagtaacgatcaccgtgaaagtaccagaagctagaata
gggaaaattactattcaatatatggatagtgaaaacaatgaattagctgaaagtaatacg
attactggcgaagttggtgaaacgtatgaaacacttgctaaagaaattgaaggctatacg
ctaaaagaaaatccagctaattcaagtggggtttttgaagaaactagacaaacgattcaa
tatatttacgtgaaagatataattaacccagaatttccagtatacagcgaaaacaacgta
acaccagaactcccaagtaacaataataactcggtcaatgggtccaggcaaacaccaagt
aaatcagtaaagaaacagtcaaaggcatactcgaaaattaatcaaatgccaatgaatctt
ccagaaacaggagatagcacaaatttactctttatttttatgggtgttctgttattagct
ggattaaccctctctaaagctaaaagaaaaaatcaataa

DBGET integrated database retrieval system