KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0171Help
Entry
LMOSLCC2479_0171  CDS       T02241                                 

Definition
(GenBank) similar to transposase, C-terminal part
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_2 rve_3 HTH_21
Motif
Other DBs
NCBI-ProteinID: CBY56442
Position
complement(172042..172671)
Genome map
AA seq 209 aa AA seqDB search
MKQEEQVGLNKVQRIMQKYQWQCQVKVKKKNRPGSAYYQTENHLNRNFQASQPLEKLTTD
ITYLYFGDCRLYLSSIMDLYNGEIVAYSIGEKQDSELVLDTLNQLSLPEGSLLHSDQGSV
YTSYEYYQCCKKKNVIRSMSRKGTPADNAPIECFHSSLKCETFYHKTAYKYAKSIVIQIV
KDYIKYYNEKRIQQKLGYQSPINFRKQAA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaagaacaagttggcctcaataaagtacagcgtattatgcaaaaatatcag
tggcaatgtcaggtaaaagtaaaaaagaaaaatcgaccaggctccgcctactatcaaaca
gaaaaccacttaaatcgaaactttcaagctagtcagccgctggaaaaattaactaccgat
atcacctacctttatttcggagactgccgtttatatttatcaagcattatggatttgtat
aatggagaaatcgttgcctactccattggcgaaaaacaagactcagaattagtgctagat
acattaaatcagttgtcccttccagaaggaagtttacttcatagcgatcaaggttcggtg
tacacatcttatgaatattatcagtgctgtaaaaagaaaaacgttatccgcagtatgtcc
cgaaaagggacacccgcagacaacgctcccatagaatgtttccattcctcgctaaagtgc
gaaacattctaccataaaacagcgtataaatacgctaaatctattgtaatccaaatcgta
aaagattacattaaatattataacgaaaaacgaattcaacaaaaattaggctaccaatct
cctattaatttcaggaaacaagcagcctaa

DBGET integrated database retrieval system