KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0209Help
Entry
LMOSLCC2479_0209  CDS       T02241                                 

Gene name
vclA
Definition
(GenBank) hypothetical protein
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_alkylation
Motif
Other DBs
NCBI-ProteinID: CBY56480
Position
complement(213700..214374)
Genome map
AA seq 224 aa AA seqDB search
MITFDQLDTELQALENPNTIKIFRNHGCPDSLDLYGLKIGDLKKIIRREKLTKNHELAVK
LIESNNSDLIYLGLLAINPNKITTEQIEKWNIAFRETWSQLTFGLASIVSKRDDALLFAK
TWIESDYDLTKSMGWQIYSEHINNLPEAETLLQRAKETLQTETNRTRYSMNGFIITCGIY
KDDLHEKAMEAAKSVGKVHVNLGNTACKVPDAISYIEKARNRTK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattacttttgaccaacttgacaccgagctacaagccttagaaaaccccaatacgatc
aaaatttttcgtaatcacggttgtccggattcattagatctttacggactaaaaattggt
gatttaaagaaaatcatccgccgagaaaaactgacaaaaaatcacgaactcgccgtaaaa
ctgattgaatcaaataatagtgacttgatttatctcggtttgctagcaattaatccaaac
aaaataaccaccgaacaaatcgaaaaatggaatatcgcttttcgcgaaacatggtcacaa
ctaacttttggactagcatcgattgtaagcaaacgtgatgatgcactccttttcgccaaa
acatggattgaaagtgattatgatttaactaaatccatgggctggcagatttacagcgaa
catattaacaatttgcctgaagcagagacattacttcaacgcgcgaaagaaacgctgcaa
acagaaaccaatagaacccgctattcaatgaacggttttattatcacttgtggaatttac
aaagacgatttgcacgaaaaagcgatggaagccgcgaaatcagtcgggaaagttcatgta
aaccttggaaatacagcttgtaaagttccagatgctatttcttatatagaaaaagcgcga
aatcgtacgaaataa

DBGET integrated database retrieval system