KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0246Help
Entry
LMOSLCC2479_0246  CDS       T02241                                 

Gene name
nusG
Definition
(GenBank) transcription antitermination factor
  KO
K02601  transcription termination/antitermination protein NusG
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lmoy03021]
    LMOSLCC2479_0246 (nusG)
   03009 Ribosome biogenesis [BR:lmoy03009]
    LMOSLCC2479_0246 (nusG)
Transcription machinery [BR:lmoy03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     LMOSLCC2479_0246 (nusG)
Ribosome biogenesis [BR:lmoy03009]
 Prokaryotic type
  rRNA transcription factors
   LMOSLCC2479_0246 (nusG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusG KOW DUF2099
Motif
Other DBs
NCBI-ProteinID: CBY56517
Position
263810..264343
Genome map
AA seq 177 aa AA seqDB search
MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEETEVKNGKTKTIKRKV
FPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPEEADRILKSMGMVEKRA
EADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGRETPVEVDFNQIEKL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaattggtatgtagttcatacttactccggttatgaaaataaagtcaaagca
aacttagaaaaacgtgtagaatcaatgggcatgtcagataaaatctttcgcgtgatcgta
ccggaagaagaagaaacagaagtgaaaaatggtaaaacaaaaacaattaaacgtaaagtt
ttccctggttatgtactagtagaaatcgttatgacagatgactcttggtatgttgttcgt
aatacccctggtgttacaggattcgttggttcagcaggttctggatcaaaaccaacacca
ttacttccagaagaagcggatcgtattcttaaaagcatgggcatggtggaaaaacgtgcg
gaagctgactttgaaattggtgaaacagttatggtcaaagaaggaccattcgctgacttc
tccggtaaagtggacgaaatggacaacgacaaaggtaaagcaaaagtcatggttaacatg
tttggacgtgaaacgccagtcgaagtggatttcaaccaaatcgaaaaactttaa

DBGET integrated database retrieval system