KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_0986Help
Entry
LMOSLCC2479_0986  CDS       T02241                                 

Gene name
dltA
Definition
(GenBank) D-alanine-activating enzyme/D-alanine-D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Pathway
lmoy00473  D-Alanine metabolism
lmoy01100  Metabolic pathways
lmoy01503  Cationic antimicrobial peptide (CAMP) resistance
lmoy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMOSLCC2479_0986 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC2479_0986 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LMOSLCC2479_0986 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lmoy01504]
    LMOSLCC2479_0986 (dltA)
Enzymes [BR:lmoy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LMOSLCC2479_0986 (dltA)
Antimicrobial resistance genes [BR:lmoy01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LMOSLCC2479_0986 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SRP_TPR_like
Motif
Other DBs
NCBI-ProteinID: CBY57257
Position
complement(1003584..1005116)
Genome map
AA seq 510 aa AA seqDB search
MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKNLITDKEKPIIVY
GHMSPLMLVAFLGSIKSGRAYVPVDVSMPVERIEQIKKAADPSMFICTEELPNNLTITGC
PVLTQDQLMDALEKHFGEVPDKEACVNNDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNW
ILQDFSLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITANMKDLYREIPAQN
LDVWVSTPSFADLCLLDENFNQENNPRLTRFLFCGEVLAKKTASELLDRFPDAVIYNTYG
PTEATVAVTQVKVTREIIDAYPSLPLGVIKPDMRLHIVDQETGEVLPEGEKGEIVLIGAS
VSKGYLNEPEKTDQVFFDYKGYQAYRTGDSGIIKDGYLFFQGRLDFQIKLHGYRIELEDI
ENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPTTHDFEKEYQLSAAIKKELKEFMPAYM
IPRKWIYKTDFPLTMNGKIDRKSLNSEVNK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgagtatcatagaaagaattgatgcatgggcagagaagacaccggatttccct
tgctatgaatatgctggaacacgtctttcctataaagaactaaaacggcaatctgatgca
ttcggctcttttctactaaaaaacctaattactgacaaagaaaaacctattatcgtttac
ggccatatgtctcccctaatgttagttgcattcttaggctctatcaaatcaggtcgagct
tatgtaccagtagatgtttctatgccagttgaacgtatagaacaaataaaaaaagcagct
gatccttctatgtttatttgcacagaagagctgcctaacaaccttactattactggttgt
ccggtgctaacacaagatcagctaatggacgctttagaaaaacatttcggagaagttcca
gacaaagaagcatgtgtaaacaatgatgataactactatattatttacacatctggaagt
acaggaaatcctaaaggcgttcaaatcagtcaaaacaacctagtaagttttagtaactgg
attttacaagacttttctttaagccaaggattgcgtttcttaaaccaagcgcccttctcc
ttcgatctatccgttatggatttatacccaagtttactatcgggtgggacgcttgtacct
cttgataaaacaattactgcgaatatgaaagatctatatcgtgaaatacctgctcaaaac
ttggatgtatgggtttctactccttcttttgcagatttgtgcttactagacgagaacttt
aaccaagaaaataacccccgcttaactcgtttcttattctgtggtgaagtacttgccaag
aaaacagcaagcgaattactggaccgtttcccagatgcagttatttacaacacatacgga
cctacagaagcaaccgtggctgttacccaagtgaaagtaactcgagagattatcgatgct
tatccaagcttaccacttggcgttattaaaccagatatgcgtttacacatcgttgaccaa
gaaactggtgaggttcttccagaaggcgaaaaaggagaaattgtcctaattggtgctagc
gtttctaaaggttacttaaatgaacctgaaaaaacagaccaagtattcttcgattataaa
ggttatcaagcctatcgcacaggagactctggtattatcaaagacggttatctgttcttc
caaggacgtcttgacttccaaattaaacttcatggttaccgcatcgaattagaagatatc
gaaaacaacctaaaaaaagtaagttacattcaaaactgcgctattattccgaaaatgaaa
gatgaaaaggtagatatgttagtcgctcaggtcatcccaactacccatgatttcgaaaaa
gaataccagctaagtgcagcaataaaaaaagaactaaaagaatttatgccagcatacatg
atcccccgaaaatggatttataaaacggacttcccgttaactatgaatggcaaaattgat
cgcaaatcacttaatagtgaggttaacaagtga

DBGET integrated database retrieval system