KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_1643Help
Entry
LMOSLCC2479_1643  CDS       T02241                                 

Gene name
ackA-2
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Pathway
lmoy00430  Taurine and hypotaurine metabolism
lmoy00620  Pyruvate metabolism
lmoy00640  Propanoate metabolism
lmoy00680  Methane metabolism
lmoy01100  Metabolic pathways
lmoy01120  Microbial metabolism in diverse environments
lmoy01200  Carbon metabolism
Module
lmoy_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2479_1643 (ackA-2)
   00640 Propanoate metabolism
    LMOSLCC2479_1643 (ackA-2)
  09102 Energy metabolism
   00680 Methane metabolism
    LMOSLCC2479_1643 (ackA-2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2479_1643 (ackA-2)
Enzymes [BR:lmoy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LMOSLCC2479_1643 (ackA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CBY57914
Position
complement(1643142..1644359)
Genome map
AA seq 405 aa AA seqDB search
MEGIDKNKMEKTIAINAGSSSLKFQLYDMPSERVITAGIVERIGLKDSIFTITVDGEKIK
EIIDIPDHEIAVQMLLEKLINHKVIGSYDEITGIGHRVVHGGERFPESVYIDDQVIKDIE
ALSELAPLHNPANVTGIKAFRKILPDVVSVAVFDTAFHQTMPPASYLYSLPYSYYEDYGI
RKYGFHGTSHKYVSERAAELLGRPVEELRLLTCHLGNGASIAAIEGGKSMDTSMGFTPLA
GVSMGTRSGNIDPALIPFIMEKTGKTAEQVLDVLNKESGMLGVSGISSDLRDLEDEAAKG
NDRAELALQVFVDRIHKYIGSYAARMNGVDAIIFTAGIGENSSYIREKVLRGLEFMGVYW
DPALNQVRGEERFLNYPHSPVKVIIIPTNEELMIARDVETIKNNR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaattgacaaaaacaaaatggaaaaaacgattgcaattaacgccggaagttct
tcactgaaattccaattatatgatatgccatctgaacgtgttatcacagcagggattgta
gaaagaattggtttgaaagattctatttttacaattactgtagacggagaaaaaatcaaa
gaaattattgatattcctgaccatgaaattgctgttcaaatgctacttgaaaaattaatt
aaccacaaagttatcggttcttacgatgaaatcactggaattggtcaccgcgttgttcac
ggtggagaaagattccctgaatccgtttatattgatgaccaagtaattaaagatattgaa
gctctatctgaacttgcaccgcttcataacccagcgaacgttactggtattaaagcattc
cgcaagattttaccagacgttgtttcagtggctgttttcgatacagctttccatcaaaca
atgcctccagcaagttatctttacagcctgccatacagctattatgaagactatggtatc
cgtaaatacggtttccacggtacaagtcacaaatatgtatccgaacgcgctgcagaactt
ttaggacgtcctgtagaagaattacgtttactaacttgtcaccttggtaatggtgctagt
atcgctgcaatcgaaggcggaaaatcaatggacacttccatgggattcacaccactagct
ggtgtttctatgggaactcgttctggtaacattgaccctgcgcttattcctttcatcatg
gaaaaaactggtaaaactgcagaacaagtacttgatgtgttaaacaaagaatctggtatg
cttggcgtatctggtatttcaagcgaccttcgtgatttagaagatgaagcagcaaaagga
aacgaccgcgcggaacttgcacttcaagttttcgttgaccgtatccataaatacattggt
tcttatgcagctcgcatgaacggtgtagatgccattatcttcacagctggtatcggtgaa
aatagttcatacatccgtgaaaaagtacttcgtggacttgaattcatgggcgtatactgg
gatccagcacttaaccaagtgcgcggagaagaaagattccttaactacccacattcccca
gtaaaagttatcatcattcctacaaacgaagaattaatgattgctcgtgatgtagaaaca
attaaaaataatcgctaa

DBGET integrated database retrieval system