KEGG   Listeria monocytogenes J1-220 (serotype 4b): LM1816_01567Help
Entry
LM1816_01567      CDS       T02801                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmoz  Listeria monocytogenes J1-220 (serotype 4b)
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LM1816_01567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ferlin_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: EGF38750
Position
213137..214144
Genome map
AA seq 335 aa AA seqDB search
MDTVILITVIIVIMGLAFDFINGFHDIANAVATSISTRALKPRVAIGIAAVMNFLGAISF
TGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMPSSSSHALIGAIAGASI
ASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLFHDKKLGKMNRRFRFIQI
GTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWVQVSCAASMAIGSSVGGYR
IIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTTQVIDSSIMGVGTANHKKEV
NWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttattttaattacggttattatcgttataatgggcttagcatttgatttt
ataaatggatttcatgatattgcaaatgctgtggccacaagtatttcaactagagcttta
aaaccgcgagtggcaattggaattgcggcagtcatgaattttctgggagccatttcgttt
accggagtagctgaatcgctcaccaaaagtattgtagatccattttcgcttaataatgga
gagtttgtcgttttatgcggcttaattgcggcagtgatttggaatttgatgacttggctt
gttggcatgcctagtagttcctcgcatgcgcttatcggtgcgatagctggggcctccatc
gcatcagccagtagttttagcgtgcttaattggtcaggatttacaactattattattgca
ctcattatctcgccgattatcggttttacagtaggttatttgatttattcactctttaag
catctttttcacgacaaaaagcttgggaagatgaatcgacgctttcgttttatccaaatt
ggaacagctgccgcccaagcatattcacacggcacaaatgatgcccaaaaaacgatggga
attatcacgcttgctttagttgcgagtgggcttttgaaagagtcagctggtattcctttt
tgggtgcaagtaagttgtgcggcatcgatggcgattggatcgtctgttggtggttatcga
atcatcaaaacagtaggaactaaaatcatgaaaatcaccccagttacaggtgttgcgtcc
gatttaagctcactttctgtaatcatgacagctactttgattcatttgccagtcagcact
acgcaagttattgacagctcgattatgggtgtcggaacagctaaccataaaaaagaagtc
aattggcgtacgggaaaaaatatggttgtaacttggtttatcacgttaccactagctgga
cttttggcagcagtggtatactggatatcagcagctatttttttataa

DBGET integrated database retrieval system