KEGG   Listeria monocytogenes J1-220 (serotype 4b): LM1816_05925Help
Entry
LM1816_05925      CDS       T02801                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoz  Listeria monocytogenes J1-220 (serotype 4b)
Pathway
lmoz00071  Fatty acid degradation
lmoz00072  Synthesis and degradation of ketone bodies
lmoz00280  Valine, leucine and isoleucine degradation
lmoz00310  Lysine degradation
lmoz00362  Benzoate degradation
lmoz00380  Tryptophan metabolism
lmoz00620  Pyruvate metabolism
lmoz00630  Glyoxylate and dicarboxylate metabolism
lmoz00640  Propanoate metabolism
lmoz00650  Butanoate metabolism
lmoz00900  Terpenoid backbone biosynthesis
lmoz01100  Metabolic pathways
lmoz01110  Biosynthesis of secondary metabolites
lmoz01120  Microbial metabolism in diverse environments
lmoz01130  Biosynthesis of antibiotics
lmoz01200  Carbon metabolism
lmoz01212  Fatty acid metabolism
lmoz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LM1816_05925
   00630 Glyoxylate and dicarboxylate metabolism
    LM1816_05925
   00640 Propanoate metabolism
    LM1816_05925
   00650 Butanoate metabolism
    LM1816_05925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LM1816_05925
   00072 Synthesis and degradation of ketone bodies
    LM1816_05925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LM1816_05925
   00310 Lysine degradation
    LM1816_05925
   00380 Tryptophan metabolism
    LM1816_05925
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM1816_05925
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LM1816_05925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LM1816_05925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoz04147]
    LM1816_05925
Enzymes [BR:lmoz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LM1816_05925
Exosome [BR:lmoz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM1816_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: EGF36691
Position
complement(1231096..1232265)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALNKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaaacaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system