KEGG   Listeria monocytogenes J1-220 (serotype 4b): LM1816_16665Help
Entry
LM1816_16665      CDS       T02801                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lmoz  Listeria monocytogenes J1-220 (serotype 4b)
Pathway
lmoz00450  Selenocompound metabolism
lmoz00970  Aminoacyl-tRNA biosynthesis
lmoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LM1816_16665
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LM1816_16665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoz01007]
    LM1816_16665
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmoz03016]
    LM1816_16665
Enzymes [BR:lmoz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LM1816_16665
Amino acid related enzymes [BR:lmoz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LM1816_16665
Transfer RNA biogenesis [BR:lmoz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LM1816_16665
 Prokaryotic type
   Other AARSs
    LM1816_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: AGR29501
Position
2969229..2971226
Genome map
AA seq 665 aa AA seqDB search
MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKI
QAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGD
IYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKY
ADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVW
IDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVF
GHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVN
FDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEGSMDHMQF
SVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTR
TPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAEVEVTFIQDEMKG
SAPAPAKEAAEVEALETPQIGIEDFDKIDLRVAEVKQVDKVKKADKLLCFQLDLGEGKLR
QVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMSEGMILSGEKDGKLSVIEASSALPN
GAKVK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcctgaagagaaaaatacgttttatattaccacaccaatctattatccaagcgga
aaagcgcatatcggccatgcttatacgactgttgcgggggacgcgatggctcgttataaa
cgcttaaaaggatatgatgtgttttacttaactggaacagatgagcacggtcaaaaaatc
caagcaaaagcgaaagaacgcggaatttctgaacaagaatacgtggatgaaatcgcagaa
ggtttccaagaactttggaaaaaactagaaatttctaatacggattttattcgtacaaca
caagaccgtcataaaacatcggttgaaaaaatctttgaacaacttttagaacaaggcgac
atttacttaggtgaatacgaaggttggtactctgtttctgatgaagaatactttacagaa
acacagttagaagaagtatataaagatgaaaatggtaaagtaatcggcggaaaagcccca
agtggcaatgaagtcgaactagtgaaagaagaatcctacttcttccgtatgagcaaatat
gcggaccgtttagtagaatattataattcccatccagaatttatccttcctgaatctaga
aaaaatgaaatgattaataatttcatcaaacctggtttggaagatttagctgtatctaga
acaacttttgattggggtattaaagttcctggcaatccaaaacacgttgtttatgtatgg
attgacgcgctttctaactatattactgcgcttgggtataatacggacaatgacacgaaa
ttccaaaaatactggcctgctgatgtacaaatcgttgggaaagaaatcgttcgtttccac
acgatttattggccaattatgctgatggcactagacttaccacttccaaaaatggtgttc
ggccacggctggattctaatgaaagatggtaaaatgtctaaatccaaagggaatgtagta
gatccttatatgctgattgaccgctacggcctagatgcgcttcgttattacttattacgc
gaagttccatttggttcagatggtttatttacaccggaagactttgttgatcgtgtgaac
tttgatcttgccaacgatttaggaaacttacttaatcgtacagtagcaatgattaataag
tactttgatggcgaaattccggcttatcaaggcaatgtaacagaattcgatcaaacctta
gtggatttcaaaaacaatgtggtgaaggaatatgaaggtagcatggatcacatgcaattc
tctgtagctttaaaccaactgtggtcactaatttctcgtacaaataaatatatcgatgaa
accgctccatggacacttgccaaagacgaagataaacgcacagaacttgcgagcgtaatg
actcatttagcagaaaacttacgtattatcgcagtacttttgcaaccattcttaacaaga
actccaggcgaaatcttcttacaactaggtttacaagaagaaaacttgaaaaaatgggat
agcatctatggatacggtgaaattccagctggcacaacagtggtgaaaaaaggtacgcca
attttcccaagacttgaggcagaagtagaagttacttttatccaagatgaaatgaaaggc
tctgcgccagctcctgccaaagaagcggcggaagttgaagcacttgaaacaccgcaaatc
ggcattgaagatttcgataaaatcgatcttcgtgttgcagaagtaaaacaagtagataaa
gtgaaaaaagcagataaacttctttgtttccaattagacttaggggaaggaaaactgcgc
caagtactttcaggcattgcagaattctatcaaccagaagaactaatcggcaaaaaagtt
atcgtcgtttctaacttaaaacctgtaaaacttcgcggactaatgagtgaaggaatgata
ctctcaggcgaaaaagatggtaagctaagtgtaatcgaagcaagtagcgcacttccaaat
ggtgcaaaagtaaaatag

DBGET integrated database retrieval system