KEGG   Listeria monocytogenes 07PF0776: MUO_01770Help
Entry
MUO_01770         CDS       T02040                                 

Definition
(GenBank) phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
lmp00010  Glycolysis / Gluconeogenesis
lmp00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_01770
   00500 Starch and sucrose metabolism
    MUO_01770
Enzymes [BR:lmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MUO_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: AFH78911
Position
complement(354243..355658)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLLSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccaactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggatttggtcacattactgacggtccaacaccagataacttaaaattagaagga
attgacttctatcatcgctacaaagatgatgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggattacaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctcactttcaatgaaatcaactccattttacac
gcaccattcatgagcggcggtatttctacaagcccagataaattatctcaaaaagactta
tatcaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcccaaatcggctgcatggtcctagcaatgccaacttatccgctaact
tccaacccagatgatattattgctgttatggaagcagagcgcaaaaactacttcttctcc
gacgttcatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcaaaacgcaaagctggc
gcaggaaacatcctaggcggcgtgcaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttgcgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgatgactaccgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttttaagtgcctccactgctgaaatgaaaaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system