KEGG   Listeria monocytogenes 07PF0776 (serotype 4b): MUO_07295Help
Entry
MUO_07295         CDS       T02040                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmp  Listeria monocytogenes 07PF0776 (serotype 4b)
Pathway
lmp00071  Fatty acid degradation
lmp00072  Synthesis and degradation of ketone bodies
lmp00280  Valine, leucine and isoleucine degradation
lmp00310  Lysine degradation
lmp00362  Benzoate degradation
lmp00380  Tryptophan metabolism
lmp00620  Pyruvate metabolism
lmp00630  Glyoxylate and dicarboxylate metabolism
lmp00640  Propanoate metabolism
lmp00650  Butanoate metabolism
lmp00900  Terpenoid backbone biosynthesis
lmp01100  Metabolic pathways
lmp01110  Biosynthesis of secondary metabolites
lmp01120  Microbial metabolism in diverse environments
lmp01130  Biosynthesis of antibiotics
lmp01200  Carbon metabolism
lmp01212  Fatty acid metabolism
lmp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUO_07295
   00630 Glyoxylate and dicarboxylate metabolism
    MUO_07295
   00640 Propanoate metabolism
    MUO_07295
   00650 Butanoate metabolism
    MUO_07295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MUO_07295
   00072 Synthesis and degradation of ketone bodies
    MUO_07295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUO_07295
   00310 Lysine degradation
    MUO_07295
   00380 Tryptophan metabolism
    MUO_07295
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUO_07295
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUO_07295
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MUO_07295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmp04147]
    MUO_07295
Enzymes [BR:lmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MUO_07295
Exosome [BR:lmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUO_07295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFH79981
Position
complement(1420406..1421575)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system