KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_0856Help
Entry
LMM7_0856         CDS       T01988                                 

Gene name
mvaA
Definition
(GenBank) putative hydroxymethylglutaryl-CoA reductase (degradative)
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00900  Terpenoid backbone biosynthesis
lmq01110  Biosynthesis of secondary metabolites
lmq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMM7_0856 (mvaA)
Enzymes [BR:lmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LMM7_0856 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AEH91861
UniProt: A0A0E0UU33
Position
853140..854420
Genome map
AA seq 426 aa AA seqDB search
MNAFDKFYKKTVEERRAILTEYADLNEEEEAFLASTGALSFDKANHMIENTIGIYSLPLG
LGMNMLLNDKRYVVPMAMEEPSVVAAQSAGAKLIAQNGGITGSATKRKMIGQIELISVSD
IQAAKENIIANEEQLIAIANQAHPSLQKRGGGAVEIQVRTAQTANDETLLIVHLLVDTQE
AMGANMVNTMVETLAPELEMLTNGTANMRILSNLVDEATATAVCRINPESLATKTQSGEW
VRDRIIAAYEFADADIYRAATHNKGIMNGIDAVIMAFGNDWRAVEAASHAYAARTGSYKP
MSKWSKDAEGYLVGELTLPMPVAFVGGSIGIHPIATLSKKIARVESAKELAMLVCAVGLT
QNLSALKALVTEGIQRGHMSLQAKSLAMTAGAEADEIEKVATFLQESKQLNVVAAKEFIT
KLRSGK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttttgataaattttacaaaaaaacagtagaagaacgacgtgcgattttgaca
gaatatgccgacttaaatgaagaagaggaggcatttttagcttctacaggggcgctttct
tttgataaagcgaatcatatgattgaaaacacgattggcatttattcgctgccgctcgga
ttaggaatgaacatgcttttaaatgataaacgttatgtggtaccgatggcgatggaagag
ccttctgttgtggcggcccaaagcgctggggcgaaacttattgcacaaaatggcgggata
actggaagtgcaacaaaacgaaaaatgattggtcagattgagttgatttctgtttctgat
atccaagcagcaaaagaaaacatcatcgcgaacgaagaacaactaattgctatcgctaac
caagcgcatccatcgttacaaaagcgtggcggtggtgcggttgaaattcaagtcagaaca
gcacaaacagccaacgacgaaacgttacttatcgttcatttactcgtagacacccaagaa
gcaatgggcgcgaatatggtcaatacgatggtcgaaaccttagcgccagaattagaaatg
ttgacgaacggaacagccaatatgcgtattttatctaatttagtagatgaagcgaccgca
actgctgtttgtcggattaatccagaaagtttagcaaccaaaacccagagcggtgaatgg
gttcgtgatagaatcattgctgcatatgaatttgctgatgcagacatttaccgagcagca
acacataataaaggaataatgaatggtattgatgcggtaattatggcgtttgggaacgat
tggcgcgcggtagaagcggcaagtcacgcctacgcagctagaacaggaagctacaaaccg
atgtctaagtggtcaaaagatgcggaggggtatttggttggggaattaactttaccgatg
ccagtagcctttgtaggaggttctatcggcatccatccaatcgcaacactttcgaaaaaa
attgcccgtgttgaatcagcgaaggaattagcgatgttagtatgtgccgttggattaaca
caaaatttatcagctttaaaagcactcgtaacagaaggaattcaacgcggtcatatgtca
ttacaagcgaaatcactagccatgacagccggtgcagaagcagatgagattgaaaaagta
gccacatttttacaagaaagtaaacaattaaatgtagttgctgcaaaagaatttattacc
aaattacgcagtggaaaataa

DBGET integrated database retrieval system