KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1084Help
Entry
LMM7_1084         CDS       T01988                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00010  Glycolysis / Gluconeogenesis
lmq00020  Citrate cycle (TCA cycle)
lmq00620  Pyruvate metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
Module
lmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_1084 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LMM7_1084 (pdhC)
   00620 Pyruvate metabolism
    LMM7_1084 (pdhC)
Enzymes [BR:lmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMM7_1084 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 NQRA RnfC_N GCV_H HlyD_D23 DUF896
Motif
Other DBs
NCBI-ProteinID: AEH92089
UniProt: A0A0E0UUS8
Position
1069126..1070760
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKA
ATKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataagattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcgccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtgcaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacatttgaaggtgattttgaaggagaagctagtcatgaatctactcca
gaatctccagcagaagaagctgaacttacaaacaacgatgcaacttccgctccagctaca
ggtggaaacggaacgccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatattgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggtgaacaaccagct
gcagcaacaactactgctcaaacagaagaaaaagcagctgcaccaaaagcagaaaaagca
gctacaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcgattgcaaaagcaatggtaaactcaaaacatacagctccacacgtc
actttaatggacgaaatcgaagtaactgcacttatggcacaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaacttactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgctgcagatacagaccacggtttatacgta
ccagtaattaaaaatgctgataaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctatcctaggagttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagctctttccttgagctttgaccaccgtgtaattgacggc
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system