KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1424Help
Entry
LMM7_1424         CDS       T01988                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00010  Glycolysis / Gluconeogenesis
lmq00052  Galactose metabolism
lmq00500  Starch and sucrose metabolism
lmq00520  Amino sugar and nucleotide sugar metabolism
lmq00521  Streptomycin biosynthesis
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
Module
lmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_1424 (glk)
   00052 Galactose metabolism
    LMM7_1424 (glk)
   00500 Starch and sucrose metabolism
    LMM7_1424 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LMM7_1424 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMM7_1424 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMM7_1424 (glk)
Enzymes [BR:lmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMM7_1424 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEH92429
UniProt: A0A0E0UVS9
Position
1380252..1381220
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataaaggt
gcccacattgttaaaaatattggcgactctatcaatcaaaaattaacagatttacaacta
gataatgatattttttacggtattggaatgggaaccccagggactgttaattatgaaact
ggtacagtcaaaggtgcttataacctaggttgggctgaagaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgctgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattggccatgtaacagtagttccggaaaacggttatgactgtacttgtggt
aaaaagggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatacaggtaaatctgcgcttaaagatgcaataaacaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaacc
attgataaaatttctttctatttggcattagcgcttagtcacattggtaatatgttaaat
ccagagaaaattattatcggcggtggagtttcagcggctggcgaccaattattaacacca
gtaaaaacttattttgagacaatggttttcccggcggttaaagaatctactaaattatct
attgcgacaaaagggaatgacgcagggataatcggagccgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system