KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1501Help
Entry
LMM7_1501         CDS       T01988                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00071  Fatty acid degradation
lmq00072  Synthesis and degradation of ketone bodies
lmq00280  Valine, leucine and isoleucine degradation
lmq00310  Lysine degradation
lmq00362  Benzoate degradation
lmq00380  Tryptophan metabolism
lmq00620  Pyruvate metabolism
lmq00630  Glyoxylate and dicarboxylate metabolism
lmq00640  Propanoate metabolism
lmq00650  Butanoate metabolism
lmq00900  Terpenoid backbone biosynthesis
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
lmq01212  Fatty acid metabolism
lmq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMM7_1501 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LMM7_1501 (atoB)
   00640 Propanoate metabolism
    LMM7_1501 (atoB)
   00650 Butanoate metabolism
    LMM7_1501 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMM7_1501 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LMM7_1501 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMM7_1501 (atoB)
   00310 Lysine degradation
    LMM7_1501 (atoB)
   00380 Tryptophan metabolism
    LMM7_1501 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMM7_1501 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMM7_1501 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMM7_1501 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmq04147]
    LMM7_1501 (atoB)
Enzymes [BR:lmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMM7_1501 (atoB)
Exosome [BR:lmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMM7_1501 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEH92506
UniProt: A0A0E0UVX0
Position
complement(1459096..1460265)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVELGATALKGVLERANIAPDRVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKSIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKNLRNSMLIDGLTDVYGDYHMGITAENVAEKFSVTREEQDKFAH
NSQMKAASAQEKNLFEEEIIPVKLADGSFFEADETIRANSTLEKLATLKSVFKEDGTVTA
GNASGINDGASALILMSKEKAIAENIPFIATIKVTSEVGVDPAYMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEDKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHLGVASLCIGGGIGIAIIVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaattcggtggcagt
ttgaaagacatcagtgcagtagaacttggcgctaccgctctaaaaggcgtattagaaaga
gccaacattgctccagaccgcgtagatcaagttatttttggtaacgttttacaagcaggt
ctcggtcaaaacgtagctagacaagtcgctattaaagcaggaattccttataaagtacct
ggagtcacaatcaatgaagtttgtggatctggtttaaaatcgattatgcttggaagacaa
gcgatccaattaggcgaggccgacattgtagcagtgggagggaccgaaaacatgtctcaa
gcaccactattacttaatccggaactagccggcgaagaaattgatcccaaaaacttaaga
aatagcatgttaattgatggtttaacggatgtgtacggcgattatcatatgggaattaca
gccgaaaatgtggcagaaaaattctctgtaacccgagaagagcaagataaatttgcacat
aactcccaaatgaaagcagcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
ccagtgaaacttgcagatggttcgtttttcgaagccgatgaaacgattcgtgcgaattcc
actttagaaaaactagctacattaaaaagcgtatttaaagaagatggaacagtcacagct
ggtaatgcttccgggatcaatgacggagcttctgcgcttattttaatgtcgaaggaaaag
gccattgccgaaaatattccttttatcgcgacaatcaaagtaacttcagaagttggtgtt
gatccagcatatatgggttacgcgccttactatgcagtaaatgaagcattaactaaaggc
ggatattctatcgatgacattgatctatttcatttaaatgaagcttttgcatcacagtcg
gttgccgtagctcgtgatttgaaaattccagaagataaactgaatatttacggcggagca
attgcgttaggtcatccaatcggagcatccggagcacgcattattgcctccttattaaat
gagttaaaacacgaaaataaacatcttggcgtggcttccttatgtatcggcggcggtatt
ggaattgcaattattgtcgaaagagcttga

DBGET integrated database retrieval system