KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1619Help
Entry
LMM7_1619         CDS       T01988                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction resolvasome, DNA-binding subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMM7_1619 (ruvA)
Enzymes [BR:lmq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LMM7_1619 (ruvA)
DNA repair and recombination proteins [BR:lmq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LMM7_1619 (ruvA)
    RecFOR pathway proteins
     LMM7_1619 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH PRKCSH_1 DUF2642 IMS_HHH WIYLD
Motif
Other DBs
NCBI-ProteinID: AEH92624
UniProt: A0A0E0UWB4
Position
complement(1581701..1582306)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcgcaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgttagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagtgttggtaaaaaaacagcg
cgccaaatcattctcgatttgaaaggcaagctggctgatgttgttgcaagtgaaattgtt
tatgttgcaccagaaaatgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

DBGET integrated database retrieval system