KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1639Help
Entry
LMM7_1639         CDS       T01988                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00860  Porphyrin and chlorophyll metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMM7_1639 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmq01007]
    LMM7_1639 (hemL)
Enzymes [BR:lmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LMM7_1639 (hemL)
Amino acid related enzymes [BR:lmq01007]
 Aminotransferase (transaminase)
  Class III
   LMM7_1639 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEH92644
UniProt: A0A0E0UWD6
Position
complement(1602456..1603745)
Genome map
AA seq 429 aa AA seqDB search
MQIYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYITDIDGNEYIDYVL
SWGPLILGHANPSVVQAITNAAMKGTSFGTPTEIETELAKLVIERVPSIEIVRMVSSGTE
ATMSAIRLARGYTKREKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTI
TVPYNDIEGAKLAFEKYGEEIAAVIVEPVAGNMGVVPPIEGFLEGLRELTTNYGSLLIFD
EVMTGFRVDYYSAQGYYVVTPDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGT
LSGNPLAMNAGFETVRQLTPQDYDVFRTLIKRMEEGLTEISARRQVPLSINKAGSMFGFF
FTDQKVTNFDTAKTSDLEFFRSYYREMLGQGIFLPPSQFEGVFISTMHTEKEIDKTLDAF
DTTCKILRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaatctattcaaaatctgaaaaagcatttaaagaagcgaaaaaagttttacctggt
ggtgtaaatagtcccgttcgagcatttaattccgttgatgcctcaccggtttttatggac
cacggaaaaggcgcttatattaccgatattgatggaaatgaatatatcgattacgtatta
tcttggggaccgctgattttaggtcatgcaaatccttctgttgtgcaagctattacaaat
gcagcaatgaaggggactagttttggaacacctactgaaatcgaaacagaattagcaaaa
ttagttattgaacgtgtaccctctattgaaattgttcgtatggtttcatcgggaacagaa
gcaacgatgagtgctattcgtttagctcgcggttatacaaagagagaaaaaatcttgaaa
tttgaaggaagttatcacggtcacggagattccttattaattaaagctggctcaggtgta
gcaactcttggattacctgattctccaggagttacaaaaggtcttgcagctgatactatc
acagttccatacaacgatattgagggtgcgaaactcgcttttgaaaaatacggggaagaa
atagccgcggtaatagtggaacctgttgcaggaaatatgggcgtcgttcctccgattgaa
ggatttttagaagggcttcgagaacttacaactaactatggttctttactaatttttgat
gaagttatgactggttttcgagtagattactattctgctcaaggatattatgtggtcaca
cccgatcttacctgtcttggtaaagtaattggtggtggtttaccagtaggcgcttacggc
ggtaaaaaagaaattatggaacagattgctccggctggttctatttatcaagctggaact
ttatccggaaatccgttagcaatgaatgctgggtttgaaacagtgcgccaattaacacca
caagattatgatgtttttcgcactttaattaagagaatggaagaaggtctgacagaaatt
tccgctagacgacaagtacctctttcgattaacaaagctggttctatgtttggctttttc
ttcacggatcaaaaagtaactaattttgatacagctaaaacgagtgatttagaatttttc
cgaagctattatcgagagatgttaggacaagggattttcttaccgccttctcagtttgaa
ggtgtcttcatttctacgatgcatactgagaaagaaattgataaaactctagatgcattt
gatactacgtgtaaaatacttcgtggctaa

DBGET integrated database retrieval system