KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1652Help
Entry
LMM7_1652         CDS       T01988                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00020  Citrate cycle (TCA cycle)
lmq00480  Glutathione metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
lmq01210  2-Oxocarboxylic acid metabolism
lmq01230  Biosynthesis of amino acids
Module
lmq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMM7_1652 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMM7_1652 (citC)
Enzymes [BR:lmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LMM7_1652 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEH92657
UniProt: A0A0E0UW26
Position
complement(1617895..1619157)
Genome map
AA seq 420 aa AA seqDB search
MSQKIQVENGVLKTPNNPVIPFIEGDGTGPDIWAAAKRVLDAAVKKAYNGEKEIAWKEVL
AGEKAFKQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPV
RYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSVESKKLIDFLKSEFGVDKIRFP
ETSGIGIKPISKEGTERLVRSAIEYTIKEGRKSLTLVHKGNIMKFTEGAFKNWGYDLCER
EYGDKVFTWNEYDRIKEAEGTEVADAKQKEALAAGKILVKDSIADIFLQQILTRPAEFDV
VATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLDKVNPSSV
ILSGTLLLEHIGWGEAAALINQSMEKTIAAKTVTYDFARLMDGATEVKCSEFADELIKNF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaaattcaagtagaaaacggtgtactcaaaacaccaaacaacccagtcatt
ccttttattgaaggggacggaactggtccagacatctgggcagctgcaaaacgcgtttta
gatgccgcagtaaaaaaagcttacaatggtgaaaaagaaattgcttggaaagaagtatta
gctggtgaaaaagcatttaaacaaacaggagaatggttaccacaagcgactttagataca
attgatgaatatttgattgctattaaaggaccgcttactactccaatcggtggaggtatt
cgttcactaaacgttgccctgcgccaagagttagatttatatgtttgtttacgtccagtt
cgctatttcaaaggtgttccttcaccggtgaaacgtccggaagacacagatatggtcatt
ttccgtgagaacacagaagatatttatgctgggattgaatttaaagaaggtagcgtagaa
tcgaaaaaactaatcgacttcttaaaatctgaatttggcgttgataaaatccgtttcccg
gaaacttctggtattggtattaagccaatttccaaagaaggaacagagcgtttagtacgt
tcggcgattgaatatacgattaaagaaggtcgtaaatcattaacgctcgtacacaaaggg
aatatcatgaagtttacagaaggagctttcaaaaattggggctatgacttatgtgaacgc
gaatatggcgataaagtatttacttggaatgagtatgatcgaattaaagaagcagaagga
acagaagttgctgacgcgaaacaaaaagaagcgcttgctgctggaaaaattttagtcaaa
gattcgattgcggatattttcttgcaacaaatcttaactcgcccagctgaatttgatgta
gttgctacaatgaacttgaatggagattacatttctgatgcacttgctgctcaagtaggc
ggaatcggtattgctccaggtgcgaatattaactacttaactggtcatgcaattttcgaa
gctacacatggtactgcgccgaagtatgcaggtcttgataaagtgaatccttcatcggtt
attttatctgggacacttcttcttgaacatattggttggggtgaagcggctgcattaatt
aatcagtcaatggaaaaaacaatcgctgcgaaaaccgtaacttatgattttgctcgatta
atggatggtgcgacagaagttaaatgttcggaatttgcggatgaattaataaaaaatttc
taa

DBGET integrated database retrieval system