KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_2210Help
Entry
LMM7_2210         CDS       T01988                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine/N-acetylgalactosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00520  Amino sugar and nucleotide sugar metabolism
lmq01100  Metabolic pathways
lmq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMM7_2210 (nagA)
Enzymes [BR:lmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LMM7_2210 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AEH93215
UniProt: A0A0E0UZ28
Position
2204083..2205216
Genome map
AA seq 377 aa AA seqDB search
MAVINNVKIYKENELIDAAVITEGNLIKEVCSTTPEKYSDEPTFDGNGQLLIPGMVDVHI
HGANNYDMMDGSTESIQAVSMACAETGCTSFLVTSVSSSFEDLIQMIKQTKKVIGKEKGA
KIAGIHLEGPYLNIEKKGMQNPAYLRHPDLKEMKKIFDEADGLIKMVTIAPELPGGIELI
DFLKKRGVVVAIAHSNATYEEAQNAFEQGATHITHCFNAMPAIHHRAPGLVTAALENDSV
SVQAIVDGVHLHPGIVRLIHKIKGPDKMVLTTDALQAMGVGDGEYIFGGHQVTVKEGIAR
LKDGTLASSTVTMNKSLKLSNEFGIHLQDAIQMAASTPADILGMNNFGRIEKGYVADLVL
LDKNFEVLTTWIDGEIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccgttatcaacaatgtgaaaatttacaaagaaaatgaattaatcgatgcagcagtt
attacagaaggaaatttgataaaagaagtttgttcaactactcctgaaaagtattcagat
gagccaactttcgatggaaatggacagttgctaattcccggaatggttgacgttcatatt
catggggcgaataattacgatatgatggatggctcaacagaaagcatccaagctgtttcg
atggcttgtgcggaaaccggatgtactagtttcttagtcacctcggttagttcttctttt
gaagacttgatccaaatgattaagcaaactaaaaaagtcattggaaaagagaaaggtgcc
aaaattgcaggaattcatttagaaggcccctaccttaatatagaaaaaaaaggaatgcaa
aatccagcctatttaagacaccccgatttaaaagaaatgaaaaagattttcgatgaagca
gatggtctgataaaaatggtcacaattgctccagaattgcctggaggtatcgaactcatt
gacttcttgaaaaaaagaggagttgtggtcgctattgcgcattccaatgccacttatgaa
gaagcacaaaatgctttcgaacaaggagcaactcacatcacacattgcttcaatgctatg
ccagccattcatcaccgggcaccaggacttgttacagcagccttggaaaatgattcggta
agcgttcaagccattgtagacggtgtccatctccatcctggaatcgtgcgccttattcac
aaaattaaaggaccagataaaatggttctcacaaccgatgcccttcaagctatgggagtt
ggcgacggggagtatatttttggcggtcaccaagtaacggttaaggaaggcatagctcgc
ttaaaagacgggacattagcttcaagtaccgtgacgatgaataaatccttaaagttaagt
aatgaatttgggattcacttacaagacgctattcaaatggcagcaagtacaccggcagac
attttaggaatgaacaattttggtcgaattgaaaaaggctatgtcgctgatttagtttta
cttgataaaaattttgaagttctaactacatggattgatggtgaaatatattaa

DBGET integrated database retrieval system