KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_2499Help
Entry
LMM7_2499         CDS       T01988                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00010  Glycolysis / Gluconeogenesis
lmq00051  Fructose and mannose metabolism
lmq00562  Inositol phosphate metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
lmq01230  Biosynthesis of amino acids
Module
lmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_2499 (tpiA)
   00051 Fructose and mannose metabolism
    LMM7_2499 (tpiA)
   00562 Inositol phosphate metabolism
    LMM7_2499 (tpiA)
Enzymes [BR:lmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMM7_2499 (tpiA)
Exosome [BR:lmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMM7_2499 (tpiA)
  Exosomal proteins of bladder cancer cells
   LMM7_2499 (tpiA)
  Exosomal proteins of melanoma cells
   LMM7_2499 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH93504
UniProt: A0A0E0UYV1
Position
complement(2512968..2513723)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaataaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgc
gtagctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tatttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaagtcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgcagacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system