KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_2961Help
Entry
LMM7_2961         CDS       T01988                                 

Gene name
ycjM
Definition
(GenBank) putative sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Brite
Enzymes [BR:lmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     LMM7_2961 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AEH93966
UniProt: A0A0E0V060
Position
complement(2957044..2958744)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
KKTLTTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIKEMEQS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAEFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRMSRFLVAHAVLMSIPGVPAVY
VQSILGSRNDYSGVETTGHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcgcgggtacagcaaacgcaacaacgaaagttaacacgaaaagat
cagtgggacgagaaagatattgttttaattacatatggagaccaatttaaagaggaatcc
aaaaaaacgttaacaacttttaagaaaatgtatgatagttatttaaaatcgacttttgag
gtagttcatttcttgcctttttatccttattcttcggatgatgggttttcggtcatcgat
tataaagcggtgaacccggaacttggtgattgggaagatattaaggagatggaacagtcg
gcgcggttgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtgctgacaccatttcaatttgat
tcaggaaaagtaggacatatttggacgacttttagtgaggatcaaatcgatttaaacttt
gcttctccggaagtgctttacaagatgattgatgttttgatgttctatttagaagaaggt
gcggaatatgtgcgacttgatgcggttggctttatgtggaaagtgccgggaacgagttcg
attcacttagaagagacgcatgaaatcgtgaaattatttagagatttagtagacattgca
gctccggggacgattattattaccgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcagaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcggcattattccagaagctgaaattttggctttagtgaatgatttggag
gaagaaggcgcgctcgtttcatataagcaaaatccagatggttctaagagtccgtatgaa
attaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgacttgaggatg
tcgagatttcttgtggctcatgcagtactaatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattattcaggcgtagaaacaacaggccacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcggaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacggta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system