KEGG   Listeria monocytogenes R479a (serotype 1/2a): LMR479A_1503Help
Entry
LMR479A_1503      CDS       T03180                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmr  Listeria monocytogenes R479a (serotype 1/2a)
Pathway
lmr00071  Fatty acid degradation
lmr00072  Synthesis and degradation of ketone bodies
lmr00280  Valine, leucine and isoleucine degradation
lmr00310  Lysine degradation
lmr00362  Benzoate degradation
lmr00380  Tryptophan metabolism
lmr00620  Pyruvate metabolism
lmr00630  Glyoxylate and dicarboxylate metabolism
lmr00640  Propanoate metabolism
lmr00650  Butanoate metabolism
lmr00900  Terpenoid backbone biosynthesis
lmr01100  Metabolic pathways
lmr01110  Biosynthesis of secondary metabolites
lmr01120  Microbial metabolism in diverse environments
lmr01130  Biosynthesis of antibiotics
lmr01200  Carbon metabolism
lmr01212  Fatty acid metabolism
lmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMR479A_1503 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LMR479A_1503 (thlA)
   00640 Propanoate metabolism
    LMR479A_1503 (thlA)
   00650 Butanoate metabolism
    LMR479A_1503 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMR479A_1503 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LMR479A_1503 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMR479A_1503 (thlA)
   00310 Lysine degradation
    LMR479A_1503 (thlA)
   00380 Tryptophan metabolism
    LMR479A_1503 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMR479A_1503 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMR479A_1503 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMR479A_1503 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmr04147]
    LMR479A_1503 (thlA)
Enzymes [BR:lmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMR479A_1503 (thlA)
Exosome [BR:lmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMR479A_1503 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM16725
Position
complement(1452597..1453766)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPKRVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASTQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVNPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccaaaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtacacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
aatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system